Protein Family IF05116

Metagenome Isolate
136 Members
46 Samples
135 Scaffolds
328.68 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_063986|Ga0466696_063986_2755_3879
Length
374 aa
Sequence
MPKTLSYRGGSVIYFQGDVADKICVVQKGSVRVTYQDIETGNDEHETLQPGEFFGVKSALGRYNREEDAVALQNSEIMTLSVGEFERFAMANTRIIVKMLKVFSNQLRRIHRQVTSLMVKEEQPGPEAGLFNVGEYYLKNRRYVQARYVFSRYLTYYPAGDKASEATKGLEIAESVLSEEESGVQVAALPSSGTGFIVGAGGSFALGTAGFASRPNGPQATPDGKSTGSVGNPLRSGKASAVPAVSKQIDVPKAYSVAASLIARKQYRQAYTALREIIESGSDKEYIVKSDFDIGRCLFMMEKFNDCIQHLSRVISNYPKHPELGTALFLMGRSYEKIGYKDQAAVFYKKILSVVTGEEGIGAEAKQALKELEA

📊 Sample Types

Isolate 0.7%
Metagenome 99.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Kalotermitidae 31.8%
Termopsidae 6.8%
Unclassified 6.8%
Rhinotermitidae 4.5%

🌳 Taxonomy

Archaea 2
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
10 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
45 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
46 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466716_310978 3300042605 Bacteria 3319
2 Ga0466719_289212 3300042606 Bacteria 2152
3 Ga0466703_000070 3300042636 Bacteria 1616
4 Ga0466727_137603 3300042655 Unclassified 1109
5 Ga0466711_427209 3300042615 Bacteria 10533
6 Ga0466711_506971 3300042615 Bacteria 3926
7 Ga0466715_111557 3300042616 Bacteria 2728
8 Ga0466723_016280 3300042618 Bacteria 23329
9 JGI24698J34947_10017484 3300002449 Archaea 3885
10 Ga0072940_1014418 3300005200 Bacteria 17599
11 Ga0466690_390994 3300042590 Bacteria 6744
12 Ga0466693_039002 3300042592 Bacteria 4163
13 Ga0123356_10051217 3300010049 Bacteria 3841
14 Ga0123354_10137665 3300010882 Bacteria 3042
15 Ga0466707_366271 3300042601 Bacteria 1735
16 Ga0466698_268134 3300042610 Bacteria 2383
17 Ga0466732_427024 3300042656 Bacteria 5334
18 Ga0466703_191099 3300042636 Bacteria 5399
19 Ga0466711_064978 3300042615 Bacteria 2523
20 AustNasuHG_c1000357 3300000089 Bacteria 15851
21 AustNasuHG_c1003106 3300000089 Bacteria 5991
22 JGI24698J34947_10004113 3300002449 Bacteria 7893
23 JGI24698J34947_10004992 3300002449 Bacteria 7271
24 JGI24695J34938_10022763 3300002450 Bacteria 3034
25 Ga0415639_034538 3300038395 Bacteria 7555
26 Ga0466690_322180 3300042590 Bacteria 26244
27 Ga0466691_158179 3300042593 Bacteria 9823
28 Ga0466694_319170 3300042594 Bacteria 18383
29 Ga0466696_063986 3300042596 Bacteria 4365
30 Ga0466700_147707 3300042600 Bacteria 1268
31 Ga0466719_484518 3300042606 Bacteria 1507
32 Ga0466722_212944 3300042609 Bacteria 4941
33 Ga0466705_255173 3300042612 Bacteria 9871
34 Ga0466704_234201 3300042643 Bacteria 5218
35 Ga0466704_301099 3300042643 Bacteria 16023
36 Ga0466712_067146 3300042614 Bacteria 17771
37 Ga0466712_134363 3300042614 Bacteria 9488
38 Ga0466715_385690 3300042616 Bacteria 3169
39 JGI24698J34947_10003142 3300002449 Bacteria 8946
40 JGI24695J34938_10007268 3300002450 Bacteria 6522
41 Ga0072940_1135864 3300005200 Bacteria 1544
42 Ga0466696_273150 3300042596 Bacteria 1116
43 Ga0466696_301864 3300042596 Bacteria 2868
44 Ga0123356_10000619 3300010049 Bacteria 39296
45 Ga0123353_10250608 3300010167 Bacteria 2743
46 Ga0466716_072177 3300042605 Bacteria 14821
47 Ga0466716_094974 3300042605 Bacteria 17045
48 Ga0466720_110783 3300042607 Bacteria 12469
49 Ga0466722_003624 3300042609 Bacteria 6344
50 Ga0466722_064257 3300042609 Bacteria 17947
51 Ga0466698_170034 3300042610 Bacteria 1884
52 Ga0466735_105880 3300042624 Bacteria 2790
53 Ga0466702_172769 3300042635 Bacteria 6596
54 Ga0466704_003182 3300042643 Bacteria 1326
55 Ga0466708_307922 3300042652 Bacteria 14416
56 Ga0466712_090234 3300042614 Bacteria 7801
57 Ga0466718_018877 3300042617 Bacteria 3965
58 Ga0466718_019624 3300042617 Bacteria 5790
59 AustNasuHG_c1004489 3300000089 Bacteria 5004
60 JGI24695J34938_10000054 3300002450 Bacteria 90526
61 JGI24699J35502_11127233 3300002509 Bacteria 4112
62 Ga0466699_193982 3300042597 Bacteria 2276
63 Ga0123353_10514401 3300010167 Bacteria 1739
64 Ga0466719_173306 3300042606 Bacteria 10733
65 Ga0466719_290411 3300042606 Bacteria 2224
66 Ga0466719_498429 3300042606 Bacteria 2493
67 Ga0466722_121518 3300042609 Bacteria 3903
68 Ga0466705_019373 3300042612 Bacteria 7107
69 Ga0466705_107954 3300042612 Bacteria 3458
70 Ga0466703_022881 3300042636 Bacteria 15863
71 Ga0466708_005588 3300042652 Bacteria 17842
72 Ga0466711_094699 3300042615 Bacteria 8883
73 Ga0466718_094102 3300042617 Bacteria 2669
74 Ga0466723_279391 3300042618 Bacteria 3866
75 Ga0466726_285182 3300042619 Bacteria 2488
76 AustNasuHG_c1000593 3300000089 Bacteria 12790
77 AustNasuHG_c1006043 3300000089 Bacteria 4324
78 JGI24698J34947_10000948 3300002449 Bacteria 14766
79 JGI24695J34938_10001809 3300002450 Bacteria 17535
80 Ga0074263_102292 3300005485 Bacteria 2178
81 Ga0466694_091184 3300042594 Bacteria 7807
82 Ga0466694_341290 3300042594 Bacteria 1745
83 Ga0466694_369154 3300042594 Bacteria 2497
84 Ga0466696_029581 3300042596 Bacteria 14800
85 Ga0123357_10115731 3300009784 Bacteria 3398
86 Ga0123353_10110041 3300010167 Bacteria 4439
87 Ga0466705_033841 3300042612 Bacteria 6126
88 Ga0466705_293436 3300042612 Bacteria 17863
89 Ga0466735_093542 3300042624 Unclassified 3204
90 Ga0466704_382198 3300042643 Unclassified 3316
91 Ga0466708_362559 3300042652 Bacteria 40015
92 Ga0466727_138244 3300042655 Bacteria 1200
93 Ga0466728_178467 3300042620 Bacteria 1803
94 JGI24695J34938_10000188 3300002450 Bacteria 57980
95 JGI24695J34938_10014628 3300002450 Bacteria 4059
96 Ga0072940_1103747 3300005200 Bacteria 2939
97 Ga0072941_1095277 3300005201 Bacteria 2680
98 Ga0072941_1124764 3300005201 Bacteria 1840
99 Ga0466696_175499 3300042596 Bacteria 15323
100 Ga0123356_10076067 3300010049 Bacteria 3163
101 Ga0466713_064558 3300042602 Bacteria 6443
102 Ga0466719_062280 3300042606 Unclassified 4944
103 Ga0466719_083942 3300042606 Bacteria 5276
104 Ga0466720_050842 3300042607 Bacteria 6713
105 Ga0466722_072637 3300042609 Bacteria 8065
106 Ga0466705_259077 3300042612 Bacteria 12486
107 Ga0466702_292598 3300042635 Bacteria 3138
108 Ga0466704_045441 3300042643 Bacteria 19579
109 Ga0466709_280600 3300042648 Bacteria 8545
110 Ga0466708_307101 3300042652 Bacteria 3662
111 Ga0466712_042932 3300042614 Bacteria 11222
112 Ga0466715_514480 3300042616 Bacteria 23319
113 Ga0466723_324427 3300042618 Bacteria 4585
114 Ga0466726_455156 3300042619 Bacteria 3701
115 Ga0466728_226073 3300042620 Bacteria 13706
116 JGI24698J34947_10005594 3300002449 Bacteria 6895
117 JGI24698J34947_10021884 3300002449 Archaea 3434
118 Ga0466692_125586 3300042591 Bacteria 17367
119 Ga0466691_155349 3300042593 Bacteria 5986
120 Ga0466694_020957 3300042594 Bacteria 2779
121 Ga0466696_167687 3300042596 Bacteria 24593
122 Ga0466720_083090 3300042607 Bacteria 3540
123 Ga0466720_234456 3300042607 Bacteria 15202
124 Ga0466705_354808 3300042612 Bacteria 9154
125 Ga0466731_085284 3300042622 Bacteria 9469
126 Ga0466703_267670 3300042636 Bacteria 3916
127 Ga0466704_393806 3300042643 Bacteria 32177
128 Ga0466718_042441 3300042617 Bacteria 8555
129 Ga0466718_081429 3300042617 Bacteria 3913
130 Ga0466728_030019 3300042620 Bacteria 50626
131 JGI24698J34947_10000667 3300002449 Bacteria 16665
132 JGI24698J34947_10015775 3300002449 Bacteria 4109
133 JGI24695J34938_10003611 3300002450 Bacteria 10630
134 Ga0264413_111745 3300024493 Bacteria 49890
135 Ga0415639_089473 3300038395 Bacteria 3598

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000089 AustNasuHG_c1004489 AustNasuHG_10044893 298
2 3300042606 Ga0466719_289212 Ga0466719_289212_307_1416 300
3 3300005200 Ga0072940_1135864 Ga0072940_11358642 301
4 3300002449 JGI24698J34947_10000948 JGI24698J34947_1000094810 302
5 3300042615 Ga0466711_506971 Ga0466711_506971_2163_3152 303
6 3300042624 Ga0466735_093542 Ga0466735_093542_1414_2442 304
7 3300042617 Ga0466718_018877 Ga0466718_018877_1683_2678 305
8 3300042617 Ga0466718_081429 Ga0466718_081429_1234_2229 305
9 3300002449 JGI24698J34947_10005594 JGI24698J34947_100055944 306
10 3300042597 Ga0466699_193982 Ga0466699_193982_726_1736 306
11 3300042607 Ga0466720_083090 Ga0466720_083090_2017_3018 306
12 3300042596 Ga0466696_273150 Ga0466696_273150_40_1068 307
13 3300038395 Ga0415639_034538 Ga0415639_034538_1264_2262 308
14 3300010049 Ga0123356_10076067 Ga0123356_100760672 309
15 3300042594 Ga0466694_319170 Ga0466694_319170_15243_16247 309
16 3300002449 JGI24698J34947_10021884 JGI24698J34947_100218842 310
17 3300002450 JGI24695J34938_10001809 JGI24695J34938_1000180913 310
18 3300042620 Ga0466728_030019 Ga0466728_030019_16789_17778 310
19 3300002449 JGI24698J34947_10003142 JGI24698J34947_100031423 311
20 3300024493 Ga0264413_111745 Ga0264413_11174518 311
21 3300042614 Ga0466712_042932 Ga0466712_042932_858_1853 311
22 3300005200 Ga0072940_1103747 Ga0072940_11037473 312
23 3300010167 Ga0123353_10514401 Ga0123353_105144012 312
24 3300042594 Ga0466694_341290 Ga0466694_341290_174_1190 313
25 3300042615 Ga0466711_427209 Ga0466711_427209_4226_5221 313
26 3300042622 Ga0466731_085284 Ga0466731_085284_1434_2447 313
27 3300042609 Ga0466722_121518 Ga0466722_121518_409_1398 314
28 3300042609 Ga0466722_212944 Ga0466722_212944_1507_2499 314
29 3300005200 Ga0072940_1014418 Ga0072940_10144186 315
30 3300042605 Ga0466716_094974 Ga0466716_094974_9624_10691 316
31 3300042607 Ga0466720_050842 Ga0466720_050842_1389_2396 316
32 3300042616 Ga0466715_111557 Ga0466715_111557_790_1740 316
33 3300042616 Ga0466715_385690 Ga0466715_385690_1233_2183 316
34 3300000089 AustNasuHG_c1003106 AustNasuHG_10031064 318
35 3300042607 Ga0466720_110783 Ga0466720_110783_4802_5803 318
36 3300042624 Ga0466735_105880 Ga0466735_105880_185_1201 318
37 3300042606 Ga0466719_173306 Ga0466719_173306_5544_6503 319
38 3300042636 Ga0466703_000070 Ga0466703_000070_566_1525 319
39 3300042652 Ga0466708_307922 Ga0466708_307922_8343_9353 319
40 3300042609 Ga0466722_072637 Ga0466722_072637_5688_6677 320
41 3300042610 Ga0466698_170034 Ga0466698_170034_421_1470 321
42 3300042614 Ga0466712_090234 Ga0466712_090234_5295_6296 321
43 3300042615 Ga0466711_064978 Ga0466711_064978_741_1772 321
44 3300002449 JGI24698J34947_10004113 JGI24698J34947_100041132 322
45 3300010882 Ga0123354_10137665 Ga0123354_101376652 323
46 3300042615 Ga0466711_094699 Ga0466711_094699_7040_8083 324
47 3300042618 Ga0466723_016280 Ga0466723_016280_15050_16108 324
48 3300000089 AustNasuHG_c1000357 AustNasuHG_10003579 325
49 3300042606 Ga0466719_484518 Ga0466719_484518_214_1191 325
50 3300042606 Ga0466719_498429 Ga0466719_498429_524_1501 325
51 3300042655 Ga0466727_137603 Ga0466727_137603_55_1032 325
52 3300002450 JGI24695J34938_10000054 JGI24695J34938_1000005411 326
53 3300042594 Ga0466694_020957 Ga0466694_020957_1436_2416 326
54 3300042594 Ga0466694_369154 Ga0466694_369154_180_1160 326
55 3300042609 Ga0466722_003624 Ga0466722_003624_1161_2141 326
56 3300042636 Ga0466703_191099 Ga0466703_191099_3043_4068 326
57 3300042609 Ga0466722_064257 Ga0466722_064257_8032_9015 327
58 3300042656 Ga0466732_427024 Ga0466732_427024_3151_4134 327
59 3300002450 JGI24695J34938_10007268 JGI24695J34938_100072687 328
60 3300010049 Ga0123356_10000619 Ga0123356_1000061919 328
61 3300042606 Ga0466719_062280 Ga0466719_062280_1433_2458 328
62 3300042614 Ga0466712_134363 Ga0466712_134363_3806_4792 328
63 3300042619 Ga0466726_285182 Ga0466726_285182_183_1256 328
64 3300042636 Ga0466703_022881 Ga0466703_022881_3881_4867 328
65 3300002449 JGI24698J34947_10004992 JGI24698J34947_100049926 329
66 3300002450 JGI24695J34938_10000188 JGI24695J34938_1000018844 330
67 3300042610 Ga0466698_268134 Ga0466698_268134_564_1556 330
68 3300042612 Ga0466705_019373 Ga0466705_019373_3410_4435 330
69 3300042619 Ga0466726_455156 Ga0466726_455156_72_1142 330
70 3300042635 Ga0466702_292598 Ga0466702_292598_1253_2245 330
71 3300002449 JGI24698J34947_10015775 JGI24698J34947_100157752 331
72 3300002449 JGI24698J34947_10017484 JGI24698J34947_100174842 331
73 3300042594 Ga0466694_091184 Ga0466694_091184_4837_5832 331
74 3300042617 Ga0466718_019624 Ga0466718_019624_2068_3063 331
75 3300042655 Ga0466727_138244 Ga0466727_138244_55_1050 331
76 3300002450 JGI24695J34938_10014628 JGI24695J34938_100146282 332
77 3300005485 Ga0074263_102292 Ga0074263_1022922 332
78 3300010049 Ga0123356_10051217 Ga0123356_100512174 332
79 3300010167 Ga0123353_10250608 Ga0123353_102506083 332
80 3300042592 Ga0466693_039002 Ga0466693_039002_2232_3230 332
81 3300042600 Ga0466700_147707 Ga0466700_147707_96_1094 332
82 3300042635 Ga0466702_172769 Ga0466702_172769_1721_2719 332
83 3300002450 JGI24695J34938_10022763 JGI24695J34938_100227634 333
84 3300042596 Ga0466696_301864 Ga0466696_301864_662_1690 333
85 3300042601 Ga0466707_366271 Ga0466707_366271_600_1601 333
86 3300042614 Ga0466712_067146 Ga0466712_067146_14354_15355 333
87 3300042620 Ga0466728_178467 Ga0466728_178467_637_1701 333
88 3300042643 Ga0466704_234201 Ga0466704_234201_2517_3518 333
89 3300002449 JGI24698J34947_10000667 JGI24698J34947_1000066712 334
90 3300002509 JGI24699J35502_11127233 JGI24699J35502_111272333 334
91 3300005201 Ga0072941_1095277 Ga0072941_10952772 334
92 3300005201 Ga0072941_1124764 Ga0072941_11247642 334
93 3300042605 Ga0466716_310978 Ga0466716_310978_874_1920 334
94 3300000089 AustNasuHG_c1000593 AustNasuHG_10005937 335
95 3300000089 AustNasuHG_c1006043 AustNasuHG_10060433 335
96 3300002450 JGI24695J34938_10003611 JGI24695J34938_100036117 335
97 3300042590 Ga0466690_322180 Ga0466690_322180_15893_16900 335
98 3300042606 Ga0466719_290411 Ga0466719_290411_857_1918 335
99 3300042607 Ga0466720_234456 Ga0466720_234456_9801_10808 335
100 3300042612 Ga0466705_259077 Ga0466705_259077_4079_5086 335
101 3300042617 Ga0466718_042441 Ga0466718_042441_5048_6055 335
102 3300042617 Ga0466718_094102 Ga0466718_094102_1394_2401 335
103 3300038395 Ga0415639_089473 Ga0415639_089473_258_1268 336
104 3300042612 Ga0466705_293436 Ga0466705_293436_10897_11946 336
105 3300042612 Ga0466705_354808 Ga0466705_354808_2157_3230 336
106 3300010167 Ga0123353_10110041 Ga0123353_101100412 337
107 3300042606 Ga0466719_083942 Ga0466719_083942_1821_2873 337
108 3300042643 Ga0466704_301099 Ga0466704_301099_13078_14091 337
109 3300042612 Ga0466705_255173 Ga0466705_255173_853_1869 338
110 3300042618 Ga0466723_324427 Ga0466723_324427_849_1967 338
111 3300042643 Ga0466704_393806 Ga0466704_393806_25946_26962 338
112 3300042591 Ga0466692_125586 Ga0466692_125586_8989_10008 339
113 3300042596 Ga0466696_167687 Ga0466696_167687_10661_11680 339
114 3300009784 Ga0123357_10115731 Ga0123357_101157311 340
115 3300042602 Ga0466713_064558 Ga0466713_064558_2576_3598 340
116 3300042612 Ga0466705_033841 Ga0466705_033841_1157_2209 340
117 3300042593 Ga0466691_155349 Ga0466691_155349_3760_4785 341
118 3300042643 Ga0466704_045441 Ga0466704_045441_6740_7765 341
119 3300042652 Ga0466708_362559 Ga0466708_362559_33936_34961 341
120 iso_pr_bacteria 2781125687 2781421899 344
121 3300042593 Ga0466691_158179 Ga0466691_158179_1308_2348 346
122 3300042616 Ga0466715_514480 Ga0466715_514480_7061_8104 347
123 3300042620 Ga0466728_226073 Ga0466728_226073_7519_8562 347
124 3300042596 Ga0466696_029581 Ga0466696_029581_9414_10460 348
125 3300042652 Ga0466708_005588 Ga0466708_005588_15580_16629 349
126 3300042643 Ga0466704_003182 Ga0466704_003182_199_1299 351
127 3300042643 Ga0466704_382198 Ga0466704_382198_2011_3066 351
128 3300042605 Ga0466716_072177 Ga0466716_072177_10990_12099 357
129 3300042652 Ga0466708_307101 Ga0466708_307101_1968_3041 357
130 3300042648 Ga0466709_280600 Ga0466709_280600_3107_4183 358
131 3300042596 Ga0466696_175499 Ga0466696_175499_11950_13035 361
132 3300042612 Ga0466705_107954 Ga0466705_107954_1387_2517 363
133 3300042590 Ga0466690_390994 Ga0466690_390994_841_1950 369
134 3300042618 Ga0466723_279391 Ga0466723_279391_1356_2465 369
135 3300042636 Ga0466703_267670 Ga0466703_267670_1382_2503 373
136 3300042596 Ga0466696_063986 Ga0466696_063986_2755_3879 374

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00027 cNMP_binding Cyclic nucleotide-binding domain 6 91 0.94
PF13424 TPR_12 Tetratricopeptide repeat 293 353 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.38 0.49 Low

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.