Protein Family IF05114

Metagenome Isolate
202 Members
85 Samples
167 Scaffolds
333.62 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_060914|Ga0466696_060914_13249_14472
Length
388 aa
Sequence
LYYHYIQKNEKVNTLCRFFLKFLLAAQKFYKGLRLKPIWCMIKGTQGEKNAMIIIIRADAQAEKRAELTDWVRGLGLDVHLSEGADTTVMGLVGDTSRVDIDILKALDIVKDVLRVSEPYKKANRKFHPADSVVGAGGCLAGGGKFALIAGPCSVESEAQIVSVAKKVKAAGAGLLRGGAYKPRSSPYAFQGLKEEGLRLLLLAKKETGLPVVSEITAVTQLPLFGGVDIIQVGARNMQNFELLKELGRTDKPILLKRGLSSTLEELLMSAEYIMAGGNERIILCERGIRTFEPATRNTLDISAVPWLKERTHLPVIVDPSHASGISRLVPPLSLAAAAAGADGLIIEVHEDPARALCDGPQCIKPDELLELVAKLDTVLTLTGKARA

📊 Sample Types

Isolate 17.3%
Metagenome 82.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 30.1%
Termitidae 24.1%
Blattidae 13.3%
Kalotermitidae 13.3%
Tenebrionidae 6.0%
Rhinotermitidae 3.6%
Termopsidae 3.6%
Passalidae 2.4%
Hodotermitidae 1.2%
Noctuidae 1.2%
Stratiomyidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 187
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
3 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
4 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
5 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
6 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
7 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
8 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
9 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
10 2820806175 Unclassified Actinobacteria Th196P3bin122 Isolate Unclassified
11 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
14 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
15 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
18 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
19 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
31 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
32 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 2820214248 Unclassified Kiritimatiellaeota Nt197P3bin16 Isolate Unclassified
36 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
37 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
38 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
39 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
40 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
41 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
42 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
48 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
49 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
50 2820556368 Unclassified Firmicutes Emb289P3bin92 Isolate Unclassified
51 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
52 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
53 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
54 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
55 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
56 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
57 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
60 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
61 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
62 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
63 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
64 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
65 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
66 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
67 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
68 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
69 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
70 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
71 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
72 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
73 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
74 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
75 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
76 2820215626 Unclassified Kiritimatiellaeota Nt197P3bin123 Isolate Unclassified
77 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
78 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
79 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
80 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
81 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
82 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
83 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
84 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
85 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10673327 3300010167 Bacteria 1459
2 Ga0123354_10110834 3300010882 Unclassified 3626
3 Ga0466703_196358 3300042636 Bacteria 12049
4 Ga0466704_067637 3300042643 Bacteria 7442
5 Ga0466704_281473 3300042643 Unclassified 11623
6 Ga0562374_1347 3300057007 Bacteria 29423
7 2227541293 2225789004 Bacteria 15690
8 IMNBL1DRAFT_c0001870 3300000062 Bacteria 15329
9 JGI24698J34947_10000045 3300002449 Bacteria 35900
10 Ga0068305_10139794 3300005083 Bacteria 7491
11 Ga0466692_082793 3300042591 Bacteria 2554
12 Ga0466707_223112 3300042601 Bacteria 32347
13 Ga0466707_281171 3300042601 Bacteria 10196
14 Ga0466707_309619 3300042601 Bacteria 29306
15 Ga0466707_394137 3300042601 Bacteria 2055
16 Ga0466713_050765 3300042602 Bacteria 24456
17 Ga0466713_130908 3300042602 Bacteria 7217
18 Ga0466714_018525 3300042603 Bacteria 8125
19 Ga0466720_107471 3300042607 Bacteria 39899
20 Ga0466705_427131 3300042612 Bacteria 2043
21 Ga0466712_015354 3300042614 Bacteria 1943
22 Ga0466712_080808 3300042614 Bacteria 5457
23 Ga0466718_144714 3300042617 Unclassified 2649
24 Ga0466723_076878 3300042618 Bacteria 14819
25 Ga0123356_10173332 3300010049 Bacteria 2171
26 Ga0466729_291345 3300042621 Bacteria 2157
27 Ga0466697_164964 3300042611 Bacteria 3492
28 Ga0530661_001284 3300056564 Bacteria 13295
29 Ga0072941_1110065 3300005201 Bacteria 7893
30 Ga0074263_100693 3300005485 Unclassified 1506
31 Ga0415639_278220 3300038395 Unclassified 2373
32 Ga0466690_377553 3300042590 Bacteria 42248
33 Ga0466706_000360 3300042599 Bacteria 2078
34 Ga0466706_065220 3300042599 Bacteria 13272
35 Ga0466716_331279 3300042605 Bacteria 5037
36 Ga0466719_080624 3300042606 Bacteria 5613
37 Ga0466719_393226 3300042606 Unclassified 2043
38 Ga0466720_002785 3300042607 Bacteria 44479
39 Ga0466720_045187 3300042607 Bacteria 27687
40 Ga0466720_074145 3300042607 Bacteria 15093
41 Ga0466720_183549 3300042607 Bacteria 21136
42 Ga0466720_221435 3300042607 Bacteria 1847
43 Ga0466712_084525 3300042614 Unclassified 1489
44 Ga0466715_311545 3300042616 Bacteria 4455
45 Ga0466718_094685 3300042617 Bacteria 21732
46 Ga0466726_008165 3300042619 Bacteria 1616
47 Ga0123356_10002602 3300010049 Unclassified 19237
48 Ga0123353_10021093 3300010167 Bacteria 9765
49 Ga0123353_10144064 3300010167 Bacteria 3812
50 Ga0123353_10513983 3300010167 Bacteria 1740
51 Ga0123354_10160272 3300010882 Unclassified 2675
52 JGI24705J35276_12231648 3300002504 Bacteria 4012
53 Ga0123357_10000264 3300009784 Bacteria 49951
54 Ga0466696_080984 3300042596 Bacteria 13392
55 Ga0466707_374461 3300042601 Bacteria 10848
56 Ga0466714_105110 3300042603 Bacteria 1381
57 Ga0466717_250982 3300042604 Unclassified 2464
58 Ga0466717_265074 3300042604 Bacteria 2398
59 Ga0466719_373532 3300042606 Bacteria 11756
60 Ga0466720_061149 3300042607 Bacteria 7557
61 Ga0466715_225483 3300042616 Bacteria 17023
62 Ga0466715_624800 3300042616 Bacteria 33953
63 Ga0123356_10008660 3300010049 Bacteria 10095
64 Ga0123356_10277929 3300010049 Bacteria 1768
65 Ga0123356_10389421 3300010049 Unclassified 1528
66 Ga0123353_10000033 3300010167 Bacteria 150421
67 Ga0123353_11040759 3300010167 Bacteria 1095
68 Ga0466731_188324 3300042622 Bacteria 1742
69 Ga0466735_101126 3300042624 Bacteria 5313
70 Ga0466727_236828 3300042655 Bacteria 1311
71 Ga0466697_100922 3300042611 Bacteria 9669
72 Ga0466732_062922 3300042656 Bacteria 10071
73 Ga0415639_057658 3300038395 Bacteria 5933
74 Ga0466696_060914 3300042596 Bacteria 15728
75 Ga0466706_152882 3300042599 Bacteria 22861
76 Ga0466707_005520 3300042601 Bacteria 8481
77 Ga0466707_180128 3300042601 Bacteria 26116
78 Ga0466713_130478 3300042602 Bacteria 4098
79 Ga0466720_173608 3300042607 Bacteria 13917
80 Ga0466720_230109 3300042607 Bacteria 6285
81 Ga0466722_025859 3300042609 Bacteria 11099
82 Ga0466712_109001 3300042614 Bacteria 1762
83 Ga0466712_270219 3300042614 Bacteria 2498
84 Ga0466715_146797 3300042616 Bacteria 104288
85 Ga0466723_256839 3300042618 Bacteria 5583
86 Ga0466726_137958 3300042619 Bacteria 8871
87 Ga0466726_460934 3300042619 Unclassified 1880
88 Ga0123355_10003806 3300009826 Bacteria 21816
89 Ga0123355_10011819 3300009826 Bacteria 13488
90 Ga0123355_10266778 3300009826 Bacteria 2386
91 Ga0123353_10135344 3300010167 Bacteria 3952
92 Ga0466704_114770 3300042643 Bacteria 11421
93 Ga0466727_086783 3300042655 Bacteria 1739
94 Ga0466727_136574 3300042655 Bacteria 2416
95 Ga0562379_0078 3300056790 Bacteria 360595
96 Ga0562379_3294 3300056790 Unclassified 11029
97 Ga0562375_0013 3300056856 Bacteria 1229523
98 JGI24698J34947_10002653 3300002449 Bacteria 9640
99 Ga0264413_135114 3300024493 Bacteria 31922
100 Ga0264413_154967 3300024493 Bacteria 1745
101 Ga0466707_036264 3300042601 Bacteria 39071
102 Ga0466707_123549 3300042601 Bacteria 35504
103 Ga0466713_013713 3300042602 Bacteria 305540
104 Ga0466719_048415 3300042606 Bacteria 7389
105 Ga0466720_140585 3300042607 Bacteria 5497
106 Ga0466718_098872 3300042617 Bacteria 4026
107 Ga0466723_212674 3300042618 Bacteria 7734
108 Ga0466726_490568 3300042619 Bacteria 9273
109 Ga0123357_10124949 3300009784 Bacteria 3226
110 Ga0123353_10198279 3300010167 Bacteria 3162
111 Ga0123353_10524549 3300010167 Bacteria 1717
112 Ga0466731_042850 3300042622 Bacteria 1104
113 Ga0466703_371831 3300042636 Bacteria 42267
114 Ga0466703_389791 3300042636 Bacteria 2498
115 Ga0466704_208138 3300042643 Unclassified 4434
116 Ga0466705_276137 3300042612 Bacteria 2219
117 Ga0466705_315599 3300042612 Bacteria 222244
118 Ga0562375_0096 3300056856 Bacteria 273717
119 Ga0562376_0690 3300056857 Bacteria 56078
120 IMNBL1DRAFT_c0027893 3300000062 Bacteria 2116
121 AustNasuHG_c1021528 3300000089 Bacteria 2085
122 JGI24702J35022_10003503 3300002462 Bacteria 9456
123 JGI24702J35022_10069034 3300002462 Bacteria 1900
124 Ga0415639_027095 3300038395 Bacteria 13479
125 Ga0466707_320159 3300042601 Bacteria 17010
126 Ga0466712_250175 3300042614 Bacteria 21394
127 Ga0466726_350007 3300042619 Bacteria 45709
128 Ga0123355_10008261 3300009826 Bacteria 15724
129 Ga0123355_10015839 3300009826 Bacteria 11861
130 Ga0123353_10000266 3300010167 Bacteria 65359
131 Ga0123353_10105276 3300010167 Bacteria 4546
132 Ga0123354_10248944 3300010882 Bacteria 1806
133 Ga0466729_284652 3300042621 Bacteria 1903
134 Ga0466708_038123 3300042652 Bacteria 39880
135 Ga0466705_249874 3300042612 Bacteria 13419
136 Ga0466732_392923 3300042656 Bacteria 1430
137 Ga0562379_1319 3300056790 Bacteria 29488
138 Ga0562375_0035 3300056856 Bacteria 623265
139 JGI24702J35022_10002602 3300002462 Bacteria 10962
140 Ga0052191_101586 3300003097 Unclassified 1100
141 Ga0466696_226681 3300042596 Bacteria 10889
142 Ga0466707_031147 3300042601 Bacteria 11612
143 Ga0466707_076846 3300042601 Bacteria 1473
144 Ga0466707_326586 3300042601 Bacteria 5495
145 Ga0466714_018036 3300042603 Bacteria 1465
146 Ga0466714_096818 3300042603 Bacteria 5713
147 Ga0466705_438455 3300042612 Bacteria 37690
148 Ga0466712_095908 3300042614 Bacteria 1442
149 Ga0466715_102282 3300042616 Bacteria 28351
150 Ga0466718_032367 3300042617 Bacteria 6323
151 Ga0466726_054016 3300042619 Bacteria 2342
152 Ga0466728_004110 3300042620 Bacteria 23429
153 Ga0466728_012820 3300042620 Bacteria 3274
154 Ga0123355_10245524 3300009826 Bacteria 2529
155 Ga0123355_10456648 3300009826 Bacteria 1606
156 Ga0466735_000957 3300042624 Bacteria 2342
157 Ga0466702_063550 3300042635 Bacteria 1793
158 Ga0466704_245826 3300042643 Bacteria 1298
159 Ga0466705_209281 3300042612 Bacteria 7137
160 Ga0415639_120608 3300038395 Bacteria 3757
161 Ga0466690_098387 3300042590 Bacteria 130488
162 Ga0466707_199429 3300042601 Bacteria 4405
163 Ga0466719_256161 3300042606 Bacteria 4307
164 Ga0466720_128458 3300042607 Bacteria 29477
165 Ga0466712_265690 3300042614 Bacteria 51797
166 Ga0466726_092129 3300042619 Bacteria 6416
167 Ga0466729_046649 3300042621 Bacteria 10724

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 8030343600 8030346012 272
2 3300042599 Ga0466706_000360 Ga0466706_000360_1184_2041 285
3 3300042619 Ga0466726_008165 Ga0466726_008165_33_926 297
4 3300042603 Ga0466714_018525 Ga0466714_018525_5561_6457 298
5 3300042603 Ga0466714_105110 Ga0466714_105110_458_1363 301
6 3300056856 Ga0562375_0013 Ga0562375_0013_571598_572620 309
7 3300057007 Ga0562374_1347 Ga0562374_1347_14537_15559 309
8 3300056790 Ga0562379_0078 Ga0562379_0078_201732_202757 310
9 3300056790 Ga0562379_1319 Ga0562379_1319_6780_7805 310
10 3300056856 Ga0562375_0035 Ga0562375_0035_465094_466119 310
11 3300056856 Ga0562375_0096 Ga0562375_0096_133377_134402 310
12 3300003097 Ga0052191_101586 Ga0052191_1015861 311
13 3300056564 Ga0530661_001284 Ga0530661_001284_1560_2588 311
14 3300056790 Ga0562379_3294 Ga0562379_3294_3742_4770 311
15 iso_pr_bacteria 2820463629 2820464111 311
16 3300038395 Ga0415639_120608 Ga0415639_120608_469_1482 313
17 3300038395 Ga0415639_027095 Ga0415639_027095_11239_12255 314
18 3300056857 Ga0562376_0690 Ga0562376_0690_28991_30019 316
19 3300042617 Ga0466718_032367 Ga0466718_032367_416_1414 318
20 3300042621 Ga0466729_284652 Ga0466729_284652_724_1731 319
21 3300010167 Ga0123353_10021093 Ga0123353_100210934 321
22 3300042605 Ga0466716_331279 Ga0466716_331279_600_1601 321
23 3300042616 Ga0466715_311545 Ga0466715_311545_2322_3326 321
24 iso_pr_bacteria 2820214248 2820215454 322
25 3300042607 Ga0466720_002785 Ga0466720_002785_15078_16085 323
26 3300042601 Ga0466707_374461 Ga0466707_374461_5490_6500 325
27 3300010167 Ga0123353_10000266 Ga0123353_1000026613 327
28 3300010167 Ga0123353_10673327 Ga0123353_106733271 327
29 3300000062 IMNBL1DRAFT_c0001870 IMNBL1DRAFT_000187010 328
30 3300042614 Ga0466712_095908 Ga0466712_095908_372_1385 328
31 3300010167 Ga0123353_10000033 Ga0123353_10000033109 330
32 3300024493 Ga0264413_154967 Ga0264413_1549672 330
33 3300042591 Ga0466692_082793 Ga0466692_082793_329_1357 330
34 3300042601 Ga0466707_123549 Ga0466707_123549_15950_16942 330
35 iso_pr_bacteria 2820705605 2820705829 331
36 3300005083 Ga0068305_10139794 Ga0068305_101397949 332
37 3300042617 Ga0466718_094685 Ga0466718_094685_2722_3720 332
38 3300042656 Ga0466732_062922 Ga0466732_062922_681_1679 332
39 3300042656 Ga0466732_392923 Ga0466732_392923_192_1190 332
40 iso_pr_bacteria 2820474468 2820474860 332
41 iso_pr_bacteria 2820584674 2820586869 332
42 3300000089 AustNasuHG_c1021528 AustNasuHG_10215282 333
43 3300009826 Ga0123355_10015839 Ga0123355_100158392 333
44 3300042601 Ga0466707_223112 Ga0466707_223112_11312_12313 333
45 3300042603 Ga0466714_096818 Ga0466714_096818_2301_3302 333
46 3300042606 Ga0466719_080624 Ga0466719_080624_722_1723 333
47 3300042612 Ga0466705_209281 Ga0466705_209281_3551_4552 333
48 3300042612 Ga0466705_427131 Ga0466705_427131_722_1723 333
49 3300042618 Ga0466723_212674 Ga0466723_212674_3623_4624 333
50 3300042643 Ga0466704_208138 Ga0466704_208138_1616_2617 333
51 3300042643 Ga0466704_281473 Ga0466704_281473_2311_3312 333
52 3300009826 Ga0123355_10245524 Ga0123355_102455242 334
53 3300010167 Ga0123353_10513983 Ga0123353_105139832 334
54 3300038395 Ga0415639_278220 Ga0415639_278220_510_1514 334
55 3300042596 Ga0466696_080984 Ga0466696_080984_891_1895 334
56 3300042601 Ga0466707_309619 Ga0466707_309619_13308_14312 334
57 3300042601 Ga0466707_326586 Ga0466707_326586_3794_4798 334
58 3300042606 Ga0466719_373532 Ga0466719_373532_6872_7876 334
59 3300042606 Ga0466719_393226 Ga0466719_393226_785_1789 334
60 3300042609 Ga0466722_025859 Ga0466722_025859_2622_3626 334
61 3300042616 Ga0466715_624800 Ga0466715_624800_22040_23044 334
62 3300042618 Ga0466723_076878 Ga0466723_076878_9980_10984 334
63 3300042618 Ga0466723_256839 Ga0466723_256839_1873_2877 334
64 3300042619 Ga0466726_054016 Ga0466726_054016_1164_2168 334
65 3300042619 Ga0466726_137958 Ga0466726_137958_4770_5774 334
66 3300042619 Ga0466726_460934 Ga0466726_460934_102_1106 334
67 3300042619 Ga0466726_490568 Ga0466726_490568_5066_6070 334
68 3300042643 Ga0466704_114770 Ga0466704_114770_5159_6163 334
69 3300042655 Ga0466727_236828 Ga0466727_236828_266_1270 334
70 iso_pr_bacteria 2820362221 2820363619 334
71 iso_pr_bacteria 2820551407 2820551849 334
72 iso_pr_bacteria 2820644600 2820645765 334
73 iso_pr_bacteria 8064531044 8064534587 334
74 3300000062 IMNBL1DRAFT_c0027893 IMNBL1DRAFT_00278932 335
75 3300002504 JGI24705J35276_12231648 JGI24705J35276_122316482 335
76 3300005201 Ga0072941_1110065 Ga0072941_11100653 335
77 3300009826 Ga0123355_10456648 Ga0123355_104566482 335
78 3300010049 Ga0123356_10389421 Ga0123356_103894211 335
79 3300010167 Ga0123353_10135344 Ga0123353_101353443 335
80 3300010167 Ga0123353_10198279 Ga0123353_101982792 335
81 3300042601 Ga0466707_005520 Ga0466707_005520_5783_6790 335
82 3300042601 Ga0466707_031147 Ga0466707_031147_125_1132 335
83 3300042601 Ga0466707_036264 Ga0466707_036264_32712_33719 335
84 3300042601 Ga0466707_180128 Ga0466707_180128_5724_6731 335
85 3300042602 Ga0466713_013713 Ga0466713_013713_142109_143116 335
86 3300042602 Ga0466713_050765 Ga0466713_050765_7315_8322 335
87 3300042607 Ga0466720_045187 Ga0466720_045187_21714_22721 335
88 3300042607 Ga0466720_061149 Ga0466720_061149_549_1556 335
89 3300042607 Ga0466720_128458 Ga0466720_128458_7958_8965 335
90 3300042607 Ga0466720_140585 Ga0466720_140585_994_2001 335
91 3300042607 Ga0466720_173608 Ga0466720_173608_9583_10590 335
92 3300042607 Ga0466720_183549 Ga0466720_183549_16809_17816 335
93 3300042607 Ga0466720_221435 Ga0466720_221435_194_1201 335
94 3300042607 Ga0466720_230109 Ga0466720_230109_4890_5897 335
95 3300042612 Ga0466705_315599 Ga0466705_315599_157648_158655 335
96 3300042614 Ga0466712_080808 Ga0466712_080808_3031_4038 335
97 3300042614 Ga0466712_084525 Ga0466712_084525_393_1400 335
98 3300042614 Ga0466712_250175 Ga0466712_250175_19058_20065 335
99 3300042614 Ga0466712_265690 Ga0466712_265690_15972_16979 335
100 3300042616 Ga0466715_102282 Ga0466715_102282_22801_23808 335
101 3300042617 Ga0466718_144714 Ga0466718_144714_135_1142 335
102 3300042619 Ga0466726_350007 Ga0466726_350007_26365_27372 335
103 3300042620 Ga0466728_012820 Ga0466728_012820_268_1275 335
104 3300042622 Ga0466731_042850 Ga0466731_042850_33_1040 335
105 3300042636 Ga0466703_371831 Ga0466703_371831_16710_17717 335
106 iso_pr_bacteria 2820001644 2820002891 335
107 iso_pr_bacteria 2820408893 2820410753 335
108 3300002449 JGI24698J34947_10000045 JGI24698J34947_1000004515 336
109 3300002449 JGI24698J34947_10002653 JGI24698J34947_100026535 336
110 3300002462 JGI24702J35022_10003503 JGI24702J35022_100035037 336
111 3300005485 Ga0074263_100693 Ga0074263_1006931 336
112 3300010049 Ga0123356_10277929 Ga0123356_102779291 336
113 3300010167 Ga0123353_10105276 Ga0123353_101052763 336
114 3300010882 Ga0123354_10110834 Ga0123354_101108342 336
115 3300010882 Ga0123354_10248944 Ga0123354_102489441 336
116 3300042601 Ga0466707_394137 Ga0466707_394137_859_1869 336
117 3300042602 Ga0466713_130478 Ga0466713_130478_1928_2938 336
118 3300042602 Ga0466713_130908 Ga0466713_130908_5079_6089 336
119 3300042621 Ga0466729_291345 Ga0466729_291345_81_1091 336
120 3300042643 Ga0466704_067637 Ga0466704_067637_2829_3839 336
121 3300042655 Ga0466727_136574 Ga0466727_136574_1102_2112 336
122 iso_pr_bacteria 2820240463 2820242314 336
123 iso_pr_bacteria 2820327087 2820327494 336
124 2225789004 2227541293 2228063060 337
125 3300010049 Ga0123356_10173332 Ga0123356_101733322 337
126 3300042596 Ga0466696_226681 Ga0466696_226681_7295_8308 337
127 3300042606 Ga0466719_048415 Ga0466719_048415_4066_5079 337
128 3300042607 Ga0466720_107471 Ga0466720_107471_35301_36314 337
129 3300042612 Ga0466705_249874 Ga0466705_249874_4794_5807 337
130 3300042612 Ga0466705_276137 Ga0466705_276137_944_1957 337
131 3300042612 Ga0466705_438455 Ga0466705_438455_33708_34721 337
132 3300042614 Ga0466712_015354 Ga0466712_015354_277_1290 337
133 3300042614 Ga0466712_270219 Ga0466712_270219_865_1878 337
134 3300042616 Ga0466715_225483 Ga0466715_225483_2192_3205 337
135 3300042617 Ga0466718_098872 Ga0466718_098872_622_1635 337
136 3300042635 Ga0466702_063550 Ga0466702_063550_499_1512 337
137 3300042636 Ga0466703_389791 Ga0466703_389791_855_1868 337
138 3300009826 Ga0123355_10003806 Ga0123355_1000380620 338
139 3300010049 Ga0123356_10008660 Ga0123356_100086608 338
140 3300024493 Ga0264413_135114 Ga0264413_13511418 338
141 3300042590 Ga0466690_098387 Ga0466690_098387_44204_45220 338
142 3300042590 Ga0466690_377553 Ga0466690_377553_13446_14462 338
143 3300042601 Ga0466707_076846 Ga0466707_076846_211_1227 338
144 3300042601 Ga0466707_281171 Ga0466707_281171_4532_5548 338
145 3300042603 Ga0466714_018036 Ga0466714_018036_110_1126 338
146 3300042620 Ga0466728_004110 Ga0466728_004110_21467_22483 338
147 3300042622 Ga0466731_188324 Ga0466731_188324_122_1138 338
148 3300042624 Ga0466735_000957 Ga0466735_000957_809_1825 338
149 3300042624 Ga0466735_101126 Ga0466735_101126_2372_3388 338
150 3300042652 Ga0466708_038123 Ga0466708_038123_27400_28416 338
151 iso_pr_bacteria 2820215626 2820216848 338
152 iso_pr_bacteria 2820215626 2820217071 338
153 iso_pr_bacteria 2820414148 2820415046 338
154 3300002462 JGI24702J35022_10069034 JGI24702J35022_100690342 339
155 3300009784 Ga0123357_10124949 Ga0123357_101249492 339
156 3300009826 Ga0123355_10266778 Ga0123355_102667781 339
157 3300038395 Ga0415639_057658 Ga0415639_057658_482_1501 339
158 3300042614 Ga0466712_109001 Ga0466712_109001_227_1246 339
159 3300042616 Ga0466715_146797 Ga0466715_146797_67984_69003 339
160 3300042619 Ga0466726_092129 Ga0466726_092129_4361_5380 339
161 3300042621 Ga0466729_046649 Ga0466729_046649_2459_3478 339
162 iso_pr_bacteria 2788499854 2788759804 339
163 iso_pr_bacteria 2820257794 2820258643 339
164 iso_pr_bacteria 2820806175 2820806238 339
165 iso_pr_bacteria 2940339133 2940340870 339
166 iso_pr_bacteria 2940341480 2940342976 339
167 iso_pr_bacteria 2940343849 2940345312 339
168 iso_pr_bacteria 2940352027 2940353483 339
169 iso_pr_bacteria 2940354458 2940356002 339
170 iso_pr_bacteria 2940356891 2940358404 339
171 iso_pr_bacteria 2940359323 2940360869 339
172 iso_pr_bacteria 2940361758 2940363215 339
173 iso_pr_bacteria 2940364193 2940365637 339
174 iso_pr_bacteria 2940366561 2940368037 339
175 iso_pr_bacteria 2940368928 2940370250 339
176 3300010882 Ga0123354_10160272 Ga0123354_101602722 340
177 3300042599 Ga0466706_065220 Ga0466706_065220_4278_5300 340
178 3300042604 Ga0466717_265074 Ga0466717_265074_1170_2192 340
179 3300042606 Ga0466719_256161 Ga0466719_256161_3251_4273 340
180 3300042611 Ga0466697_100922 Ga0466697_100922_7847_8869 340
181 iso_pr_bacteria 2820556368 2820556994 340
182 3300009784 Ga0123357_10000264 Ga0123357_1000026438 341
183 3300010167 Ga0123353_11040759 Ga0123353_110407591 341
184 3300042599 Ga0466706_152882 Ga0466706_152882_19352_20377 341
185 3300042601 Ga0466707_199429 Ga0466707_199429_372_1397 341
186 3300042601 Ga0466707_320159 Ga0466707_320159_7125_8150 341
187 3300042607 Ga0466720_074145 Ga0466720_074145_11714_12739 341
188 3300042655 Ga0466727_086783 Ga0466727_086783_213_1238 341
189 3300010167 Ga0123353_10144064 Ga0123353_101440644 342
190 3300042611 Ga0466697_164964 Ga0466697_164964_1423_2451 342
191 iso_pr_bacteria 2820321184 2820322788 342
192 iso_pr_bacteria 2820424542 2820424649 343
193 3300009826 Ga0123355_10008261 Ga0123355_100082614 345
194 3300009826 Ga0123355_10011819 Ga0123355_100118199 345
195 3300010049 Ga0123356_10002602 Ga0123356_100026021 345
196 3300002462 JGI24702J35022_10002602 JGI24702J35022_100026027 347
197 3300010167 Ga0123353_10524549 Ga0123353_105245492 347
198 3300042604 Ga0466717_250982 Ga0466717_250982_573_1619 348
199 iso_pr_bacteria 2820344559 2820344684 348
200 3300042636 Ga0466703_196358 Ga0466703_196358_10921_11982 353
201 3300042643 Ga0466704_245826 Ga0466704_245826_79_1221 380
202 3300042596 Ga0466696_060914 Ga0466696_060914_13249_14472 388

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF18152 DAHP_snth_FXD DAHP synthase ferredoxin-like domain 52 118 0.99
PF00793 DAHP_synth_1 DAHP synthetase I family 140 372 0.94
PF03102 NeuB NeuB family 217 386 0.8

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00793 GO:0009058 biosynthetic process BP
PF03102 GO:0016051 carbohydrate biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.