Protein Family IF05109
Metagenome
Isolate
296
Members
253
Samples
92
Scaffolds
545.64
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_055382|Ga0466696_055382_7490_9292
- Length
- 581 aa
- Sequence
- MVVLVLADLMFRRNIAHQTLQLFILDSIHFIYFLKLMSIHELAGQPAPKSILVNVNDLEKNYYEQKPDPENPTQLVVFGTSGHRGTSLDGSFTESHILAIAQAVCDYRSQQGYTGKLYLGKDTHFLSGPAQKTALEVFAANNVEVVFQADDGFTPTPVISWAILQHNKPNTLKGNENSLADGVIITPSHNPPSDGGIKYNCPNGGPADTDVTGWIQTQANHYLKSNLKGIQRIAYEKSVALPHIQTIDFSEDYIADLENIVDLQAIAERKIRIGVDPLGGAGNAYWQPIAERYRLDLTVVNQAIDPTFSFMSVDHDGKIRMDCSSPYAMRGLVALKDQFDIAFANDPDTDRHGIVVPSVGLMNPNHYLAVAIQYLFTHRPNWAKGIGVGKTLVSSGIIDRVVSDLRLQLVEVPVGFKWFVDGLYNSNIGFGGEESAGASFLRKNGQVWSTDKDGIILNLLAAEILAKTQLDPGQIYREIEQRFGQSFYTRIDQATTPEQKSAFKKLTPDKVLAPITAKLTTASGNGASIGGLKVVSTEGWFAARPSGTENIYKIYAESFKSKEHLNNIVAEAKKIVDAALC
Sample Types
Isolate
68.9%
Metagenome
31.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.6%
Drosophilidae
9.5%
Anthocoridae
8.7%
Muscidae
5.4%
Termitidae
5.0%
Kalotermitidae
4.5%
Tenebrionidae
4.1%
Curculionidae
4.1%
Calliphoridae
3.7%
Culicidae
2.9%
Tephritidae
2.1%
Cerambycidae
1.7%
Pteromalidae
1.2%
Aphididae
1.2%
Apidae
1.2%
Armadillidiidae
1.2%
Rhinotermitidae
0.8%
Reduviidae
0.8%
Majidae
0.8%
Formicidae
0.8%
Pentatomidae
0.8%
Sarcophagidae
0.8%
Termopsidae
0.8%
Aphalaridae
0.4%
Daphniidae
0.4%
Ixodidae
0.4%
Scarabaeidae
0.4%
Ceratophyllidae
0.4%
Aleyrodidae
0.4%
Talitridae
0.4%
Cicadellidae
0.4%
Plutellidae
0.4%
Dytiscidae
0.4%
Passalidae
0.4%
Crambidae
0.4%
Rhopalidae
0.4%
Glossinidae
0.4%
Carabidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Taxonomy
Archaea
0
Bacteria
280
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 2 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 3 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 4 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 5 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 6 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 7 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 8 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 9 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 10 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 11 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 12 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 13 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 14 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 15 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 16 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 17 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 20 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 21 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 22 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 26 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 27 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 28 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 33 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 34 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 35 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 36 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 37 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 38 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 39 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 40 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 41 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 42 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 43 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 44 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 45 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 46 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 47 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 48 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 49 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 50 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 51 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 52 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 53 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 54 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 55 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 56 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 57 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 58 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 59 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 60 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 63 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 64 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 65 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 66 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 67 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 68 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 69 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 70 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 71 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 72 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 73 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 74 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 75 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 76 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 77 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 78 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 79 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 80 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 81 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 82 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 83 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 84 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 85 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 86 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 87 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 88 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 89 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 90 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 91 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 92 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 93 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 94 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 95 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 96 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 97 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 98 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 99 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 100 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 101 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 102 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 103 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 104 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 105 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 106 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 107 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 108 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 109 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 110 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 111 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 112 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 113 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 114 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 115 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 116 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 117 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 118 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 119 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 120 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 121 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 122 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 123 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 124 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 125 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 126 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 127 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 128 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 129 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 130 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 131 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 132 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 133 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 134 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 135 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 136 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 137 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 138 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 139 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 140 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 141 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 142 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 143 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 144 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 145 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 146 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 147 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 148 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 149 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 150 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 151 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 152 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 153 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 154 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 155 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 156 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 157 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 158 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 159 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 160 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 161 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 162 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 163 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 164 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 165 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 166 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 167 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 168 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 169 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 170 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 171 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 172 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 173 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 174 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 175 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 176 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 177 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 178 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 179 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 180 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 181 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 182 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 183 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 184 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 185 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 186 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 187 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 188 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 189 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 190 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 191 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 192 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 193 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 194 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 195 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 196 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 197 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 198 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 199 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 200 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 201 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 202 | 2820876581 | Unclassified Actinobacteria Lab288P1bin83 | Isolate | Unclassified |
| 203 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 204 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 205 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 206 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 207 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 208 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 209 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 210 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 211 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 212 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 213 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 214 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 215 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 216 | 8076047169 | Erwinia haradaeae ErCipseudotsugae/2889 | Isolate | Aphididae |
| 217 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 218 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 219 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 220 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 221 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 222 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 223 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 224 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 225 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 226 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 227 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 228 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 229 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 230 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 231 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 232 | 2958255616 | Serratia marcescens TM | Isolate | |
| 233 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 234 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 235 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 236 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 237 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 238 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 239 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 240 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 241 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 242 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 243 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 244 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 245 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 246 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 247 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 248 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 249 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 250 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 251 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 252 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 253 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562375_0008 | 3300056856 | Bacteria | 1786936 |
| 2 | Ga0123355_10020729 | 3300009826 | Bacteria | 10508 |
| 3 | Ga0160443_102129 | 3300012848 | Unclassified | 4867 |
| 4 | FGTW_contig32725 | 2065487013 | Unclassified | 2250 |
| 5 | Meta3P_1000048 | 3300002464 | Bacteria | 60398 |
| 6 | Ga0063521_1000099 | 3300003973 | Bacteria | 69359 |
| 7 | Ga0063521_1000181 | 3300003973 | Bacteria | 46094 |
| 8 | Ga0063521_1005616 | 3300003973 | Unclassified | 2965 |
| 9 | Ga0105005_1275156 | 3300007505 | Bacteria | 7334 |
| 10 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 11 | Ga0466703_076237 | 3300042636 | Bacteria | 2027 |
| 12 | Ga0466703_236983 | 3300042636 | Bacteria | 2218 |
| 13 | Ga0466724_03028 | 3300042649 | Unclassified | 2005 |
| 14 | Ga0466707_005362 | 3300042601 | Unclassified | 1781 |
| 15 | Ga0466713_089703 | 3300042602 | Bacteria | 37167 |
| 16 | Ga0466716_050991 | 3300042605 | Bacteria | 4301 |
| 17 | Ga0466719_500244 | 3300042606 | Bacteria | 9100 |
| 18 | Ga0123357_10047812 | 3300009784 | Bacteria | 5798 |
| 19 | Ga0123355_10323109 | 3300009826 | Bacteria | 2076 |
| 20 | Ga0123356_10027009 | 3300010049 | Bacteria | 5382 |
| 21 | Ga0466692_069337 | 3300042591 | Bacteria | 7142 |
| 22 | Ga0466693_388551 | 3300042592 | Bacteria | 8949 |
| 23 | Ga0466705_320174 | 3300042612 | Bacteria | 2602 |
| 24 | Ga0466703_233935 | 3300042636 | Bacteria | 7697 |
| 25 | Ga0466724_01259 | 3300042649 | Unclassified | 11019 |
| 26 | Ga0466708_290128 | 3300042652 | Bacteria | 5892 |
| 27 | Ga0466707_165779 | 3300042601 | Bacteria | 177707 |
| 28 | Ga0466713_103029 | 3300042602 | Bacteria | 264074 |
| 29 | Ga0123355_10017153 | 3300009826 | Unclassified | 11432 |
| 30 | Ga0123353_10001062 | 3300010167 | Bacteria | 33595 |
| 31 | Ga0123353_10001449 | 3300010167 | Bacteria | 28983 |
| 32 | Ga0160460_100026 | 3300012845 | Bacteria | 329165 |
| 33 | DPOL_contig14240 | 2035918003 | Bacteria | 36210 |
| 34 | FGTW_contig16704 | 2065487013 | Unclassified | 2136 |
| 35 | CVPL010L_1000121 | 3300002932 | Bacteria | 26369 |
| 36 | Ga0068302_10125394 | 3300005071 | Bacteria | 1755 |
| 37 | Ga0104040_1142440 | 3300007149 | Bacteria | 2794 |
| 38 | Ga0466730_045935 | 3300042625 | Bacteria | 18946 |
| 39 | Ga0466730_065045 | 3300042625 | Bacteria | 39695 |
| 40 | Ga0123355_10024762 | 3300009826 | Bacteria | 9650 |
| 41 | Ga0123356_10052959 | 3300010049 | Unclassified | 3777 |
| 42 | Ga0123356_10196610 | 3300010049 | Bacteria | 2053 |
| 43 | Ga0123353_10128737 | 3300010167 | Bacteria | 4065 |
| 44 | Ga0160455_100022 | 3300012837 | Bacteria | 376035 |
| 45 | Ga0247290_00250 | 3300035364 | Bacteria | 13934 |
| 46 | FGTW_contig30607 | 2065487013 | Bacteria | 13947 |
| 47 | Ga0063521_1000573 | 3300003973 | Bacteria | 15726 |
| 48 | Ga0466728_036519 | 3300042620 | Bacteria | 10002 |
| 49 | Ga0562374_0108 | 3300057007 | Bacteria | 213157 |
| 50 | Ga0466734_147032 | 3300042623 | Bacteria | 3319 |
| 51 | Ga0466730_000500 | 3300042625 | Bacteria | 17017 |
| 52 | Ga0466708_385492 | 3300042652 | Bacteria | 15333 |
| 53 | Ga0466727_288626 | 3300042655 | Bacteria | 4558 |
| 54 | Ga0160433_100942 | 3300012846 | Bacteria | 9651 |
| 55 | Ga0466691_093492 | 3300042593 | Bacteria | 7211 |
| 56 | FGTW_contig31053 | 2065487013 | Unclassified | 6205 |
| 57 | Ga0466724_17605 | 3300042649 | Bacteria | 124775 |
| 58 | Ga0466701_035375 | 3300042598 | Bacteria | 4099 |
| 59 | Ga0123356_10001734 | 3300010049 | Bacteria | 23772 |
| 60 | Ga0316159_10177 | 3300030930 | Bacteria | 10860 |
| 61 | FGTW_contig32849 | 2065487013 | Unclassified | 1789 |
| 62 | 2227080781 | 2225789004 | Bacteria | 168264 |
| 63 | JGI24702J35022_10013548 | 3300002462 | Bacteria | 4514 |
| 64 | Ga0104041_1001122 | 3300007106 | Unclassified | 6700 |
| 65 | Ga0466711_117399 | 3300042615 | Bacteria | 5626 |
| 66 | Ga0466715_076300 | 3300042616 | Bacteria | 22436 |
| 67 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 68 | Ga0466716_133232 | 3300042605 | Bacteria | 8500 |
| 69 | Ga0123355_10085175 | 3300009826 | Unclassified | 5031 |
| 70 | Ga0123356_10018466 | 3300010049 | Unclassified | 6621 |
| 71 | Ga0265387_1000014 | 3300024582 | Bacteria | 72789 |
| 72 | Ga0466696_055382 | 3300042596 | Bacteria | 12426 |
| 73 | Ga0063521_1000179 | 3300003973 | Bacteria | 46734 |
| 74 | Ga0074188_1000224 | 3300005318 | Bacteria | 57952 |
| 75 | Ga0466711_156461 | 3300042615 | Bacteria | 7094 |
| 76 | Ga0466711_235468 | 3300042615 | Bacteria | 4559 |
| 77 | Ga0466715_435097 | 3300042616 | Bacteria | 4257 |
| 78 | Ga0466723_141908 | 3300042618 | Bacteria | 9334 |
| 79 | Ga0562379_0244 | 3300056790 | Unclassified | 147538 |
| 80 | Ga0562377_0183 | 3300056842 | Bacteria | 165152 |
| 81 | Ga0466729_284089 | 3300042621 | Bacteria | 2197 |
| 82 | Ga0466730_062206 | 3300042625 | Bacteria | 48849 |
| 83 | Ga0466724_09622 | 3300042649 | Bacteria | 60623 |
| 84 | Ga0123355_10112789 | 3300009826 | Bacteria | 4242 |
| 85 | Ga0123355_10230938 | 3300009826 | Bacteria | 2642 |
| 86 | Ga0123354_10002351 | 3300010882 | Bacteria | 24824 |
| 87 | Ga0316159_11206 | 3300030930 | Unclassified | 3381 |
| 88 | Ga0466694_307473 | 3300042594 | Bacteria | 2092 |
| 89 | DPOL_contig01160 | 2035918003 | Bacteria | 3464 |
| 90 | CVPL010L_1000330 | 3300002932 | Bacteria | 30598 |
| 91 | Ga0466715_365310 | 3300042616 | Bacteria | 3997 |
| 92 | Ga0466729_014118 | 3300042621 | Bacteria | 40283 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02878 | PGM_PMM_I | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I | 77 | 221 | 0.96 |
| PF02880 | PGM_PMM_III | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III | 363 | 482 | 0.96 |
| PF02879 | PGM_PMM_II | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II | 251 | 355 | 0.89 |
| PF00408 | PGM_PMM_IV | Phosphoglucomutase/phosphomannomutase, C-terminal domain | 526 | 572 | 0.85 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02879 | GO:0005975 | carbohydrate metabolic process | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.91 | 0.93 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.