Protein Family IF05107

Metagenome Isolate
159 Members
70 Samples
123 Scaffolds
481.69 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_048763|Ga0466696_048763_3662_5233
Length
523 aa
Sequence
MKLSELLNIAGLGEISGGNDPEITGVYADSRQVKPGSLFVAVKGTLADGHDYIGKAVEQGAIAILCEHAVDLAEDAVTKATAFAGGDVVVGDEVPASGKSVAGVAYNTSFAGKEIVFFMAPDPAEALGRIASAWYGEPSARMTVVGVTGTNGKTTIATLLYNLFRKLGYKAGLLSTVCNYIDDEAVPTEHTTPDPLTINRLMSRMADAGCEYVFMEVSSHAIDQKRISGLDFNGGIFTNLTRDHLDYHKTVDNYLKTKKKFFDDLPASAFALTNADDKSGPVMLQNTAARKLTYSLRTMADFKGKIMESHFEGMEIDINGHDVYTHFIGRFNASNLLAVYGAAVALGEESEEILVALSTLHPVSGRFETIRSPKGFTAVVDYAHTPDALTNVLNGINEVLEGSGRVITVVGAGGGRDKGKRPLMAKEAVRQSDRLILTSDNPRFEEPDEIINDMVAGLNASDKERTLCITDRRQAIKTAVAFAQKGDVILIAGKGHEDYQDVKGEKHHFDDKEIVREIFNTEN

📊 Sample Types

Isolate 22.6%
Metagenome 77.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 45.7%
Kalotermitidae 20.0%
Termitidae 10.0%
Unclassified 10.0%
Rhinotermitidae 4.3%
Termopsidae 4.3%
Passalidae 2.9%
Hodotermitidae 1.4%
Tenebrionidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 159
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
2 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
3 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
4 2923982719 Parabacteroides sp. 52 Isolate Blattidae
5 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
6 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
7 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
15 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
16 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
17 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
23 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
26 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
27 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
28 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
29 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 3004677695 Bacteroides sp. 214 Isolate Blattidae
36 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
37 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
38 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
41 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
46 2922326829 Bacteroides sp. 224 Isolate Blattidae
47 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
48 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
49 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
50 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
51 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
52 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
53 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
54 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
55 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
56 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
57 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
58 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
59 3004672520 Bacteroides sp. 51 Isolate Blattidae
60 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
61 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
62 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
63 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
64 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
65 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
66 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
67 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
68 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_004521 3300042612 Bacteria 9564
2 Ga0466733_181724 3300042659 Bacteria 66237
3 Ga0466715_233762 3300042616 Bacteria 19149
4 Ga0466726_450811 3300042619 Bacteria 4712
5 Ga0466691_075210 3300042593 Bacteria 24277
6 Ga0466696_378568 3300042596 Bacteria 3700
7 Ga0466735_004868 3300042624 Bacteria 15556
8 Ga0466703_102327 3300042636 Bacteria 38440
9 Ga0466704_139994 3300042643 Bacteria 7248
10 Ga0466704_422764 3300042643 Bacteria 23212
11 Ga0466708_196684 3300042652 Bacteria 22308
12 Ga0466706_137590 3300042599 Bacteria 25056
13 2227108579 2225789004 Bacteria 38272
14 2227530183 2225789004 Bacteria 16381
15 Ga0068305_10042196 3300005083 Bacteria 15988
16 Ga0466705_029189 3300042612 Bacteria 2842
17 Ga0466732_080661 3300042656 Bacteria 5256
18 Ga0466733_050745 3300042659 Bacteria 18476
19 Ga0466711_220444 3300042615 Bacteria 19427
20 Ga0466696_410620 3300042596 Bacteria 25661
21 Ga0466735_015542 3300042624 Bacteria 2335
22 Ga0466735_082455 3300042624 Bacteria 10716
23 Ga0466704_320437 3300042643 Bacteria 10713
24 Ga0466706_002382 3300042599 Bacteria 3045
25 Ga0466706_051828 3300042599 Bacteria 24965
26 Ga0466706_218375 3300042599 Bacteria 57228
27 Ga0466713_035486 3300042602 Bacteria 12858
28 Ga0466713_099964 3300042602 Bacteria 24145
29 Ga0466714_051125 3300042603 Bacteria 52861
30 Ga0466719_429770 3300042606 Bacteria 16643
31 Ga0466722_147385 3300042609 Bacteria 8778
32 IMNBL1DRAFT_c0001589 3300000062 Bacteria 16869
33 Ga0466733_146065 3300042659 Bacteria 12551
34 Ga0562377_0004 3300056842 Bacteria 3525959
35 Ga0466711_196075 3300042615 Bacteria 21098
36 Ga0466723_076286 3300042618 Bacteria 8324
37 Ga0466696_185074 3300042596 Bacteria 8022
38 Ga0466696_299474 3300042596 Bacteria 22051
39 Ga0466704_041870 3300042643 Bacteria 10680
40 Ga0466706_151978 3300042599 Bacteria 59315
41 Ga0466713_130991 3300042602 Bacteria 214088
42 Ga0466719_042604 3300042606 Bacteria 12458
43 Ga0466733_201766 3300042659 Bacteria 18252
44 Ga0466715_340014 3300042616 Bacteria 11262
45 Ga0466723_276908 3300042618 Bacteria 21481
46 Ga0466691_071799 3300042593 Bacteria 28796
47 Ga0466696_048763 3300042596 Bacteria 5255
48 Ga0466729_203041 3300042621 Bacteria 16265
49 Ga0466703_021603 3300042636 Bacteria 26593
50 Ga0466704_174538 3300042643 Bacteria 20210
51 Ga0466706_088248 3300042599 Bacteria 22894
52 Ga0466706_233154 3300042599 Bacteria 17851
53 Ga0466707_035097 3300042601 Bacteria 8598
54 Ga0466713_156423 3300042602 Bacteria 30043
55 Ga0466716_333892 3300042605 Bacteria 18676
56 2227425264 2225789004 Bacteria 5592
57 Ga0068305_10112672 3300005083 Bacteria 7799
58 Ga0466705_191266 3300042612 Bacteria 24237
59 Ga0466732_023507 3300042656 Bacteria 80252
60 Ga0466733_035306 3300042659 Bacteria 102874
61 Ga0466715_335119 3300042616 Bacteria 21011
62 Ga0466726_186310 3300042619 Bacteria 5641
63 Ga0466690_080563 3300042590 Bacteria 27019
64 Ga0466692_063390 3300042591 Bacteria 95171
65 Ga0466696_043628 3300042596 Bacteria 22568
66 Ga0466709_197664 3300042648 Bacteria 8558
67 Ga0466725_246022 3300042654 Bacteria 27455
68 Ga0466706_011190 3300042599 Bacteria 34638
69 Ga0466706_011465 3300042599 Bacteria 14456
70 Ga0466705_434662 3300042612 Bacteria 10118
71 Ga0466711_221321 3300042615 Bacteria 28835
72 Ga0466711_426937 3300042615 Bacteria 4203
73 Ga0466723_344968 3300042618 Bacteria 22473
74 Ga0466728_226309 3300042620 Bacteria 11273
75 Ga0466690_165942 3300042590 Bacteria 42807
76 Ga0466696_025150 3300042596 Bacteria 5175
77 Ga0466735_125124 3300042624 Bacteria 3753
78 Ga0466703_288873 3300042636 Bacteria 2780
79 Ga0466704_137465 3300042643 Bacteria 13412
80 Ga0466704_312751 3300042643 Bacteria 10651
81 Ga0466709_056442 3300042648 Bacteria 70841
82 Ga0466708_293328 3300042652 Bacteria 56768
83 Ga0466708_431015 3300042652 Bacteria 60350
84 Ga0466727_148601 3300042655 Bacteria 6313
85 Ga0466707_137968 3300042601 Bacteria 35577
86 Ga0466707_159669 3300042601 Bacteria 505639
87 Ga0466707_229461 3300042601 Bacteria 26081
88 Ga0466713_016019 3300042602 Bacteria 439221
89 Ga0466713_043835 3300042602 Bacteria 33934
90 Ga0466713_119808 3300042602 Bacteria 48294
91 Ga0466713_140837 3300042602 Bacteria 175760
92 Ga0466714_006756 3300042603 Bacteria 211810
93 Ga0466698_454723 3300042610 Bacteria 4354
94 IMNBL1DRAFT_c0001729 3300000062 Bacteria 16026
95 Ga0466705_119745 3300042612 Bacteria 31799
96 Ga0466705_359873 3300042612 Bacteria 14759
97 Ga0123356_10045025 3300010049 Bacteria 4106
98 Ga0466715_078929 3300042616 Bacteria 42957
99 Ga0466726_079499 3300042619 Bacteria 13489
100 Ga0466735_129957 3300042624 Bacteria 3100
101 Ga0466703_162819 3300042636 Bacteria 2717
102 Ga0466703_395996 3300042636 Bacteria 28558
103 Ga0466704_602482 3300042643 Bacteria 52119
104 Ga0466707_272065 3300042601 Bacteria 2423
105 Ga0466716_149833 3300042605 Bacteria 35494
106 2227266896 2225789004 Bacteria 6961
107 IMNBL1DRAFT_c0000216 3300000062 Bacteria 50594
108 Ga0466733_222052 3300042659 Bacteria 81292
109 Ga0123357_10053426 3300009784 Bacteria 5451
110 Ga0466711_073849 3300042615 Bacteria 19235
111 Ga0466711_241205 3300042615 Bacteria 25347
112 Ga0466692_008888 3300042591 Bacteria 27213
113 Ga0466692_192950 3300042591 Bacteria 19478
114 Ga0466691_212492 3300042593 Bacteria 29583
115 Ga0466704_510642 3300042643 Bacteria 18412
116 Ga0466725_054693 3300042654 Bacteria 33575
117 Ga0466706_193089 3300042599 Bacteria 58339
118 Ga0466713_129978 3300042602 Bacteria 70140
119 Ga0466714_101275 3300042603 Bacteria 2012
120 2227544076 2225789004 Bacteria 15432
121 IMNBL1DRAFT_c0009023 3300000062 Bacteria 4999
122 Ga0068305_10004429 3300005083 Bacteria 74318
123 Ga0068305_10047479 3300005083 Bacteria 8111

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_011465 Ga0466706_011465_6376_7839 436
2 3300042599 Ga0466706_051828 Ga0466706_051828_4783_6240 436
3 3300042624 Ga0466735_129957 Ga0466735_129957_1138_2589 437
4 3300042624 Ga0466735_015542 Ga0466735_015542_460_1911 444
5 3300042624 Ga0466735_004868 Ga0466735_004868_9887_11338 445
6 3300042624 Ga0466735_125124 Ga0466735_125124_1573_3024 445
7 3300042599 Ga0466706_011190 Ga0466706_011190_24393_25850 446
8 3300042599 Ga0466706_137590 Ga0466706_137590_17960_19417 446
9 3300042615 Ga0466711_220444 Ga0466711_220444_13293_14747 446
10 3300042593 Ga0466691_212492 Ga0466691_212492_22531_23988 448
11 3300042615 Ga0466711_426937 Ga0466711_426937_1810_3270 448
12 3300042599 Ga0466706_151978 Ga0466706_151978_9150_10616 449
13 3300042601 Ga0466707_035097 Ga0466707_035097_2890_4344 449
14 2225789004 2227425264 2227865781 452
15 3300042612 Ga0466705_029189 Ga0466705_029189_635_2095 452
16 3300000062 IMNBL1DRAFT_c0000216 IMNBL1DRAFT_000021619 459
17 3300042659 Ga0466733_050745 Ga0466733_050745_8442_9902 459
18 3300042612 Ga0466705_434662 Ga0466705_434662_6603_8054 463
19 2225789004 2227108579 2227495883 464
20 3300005083 Ga0068305_10004429 Ga0068305_1000442957 466
21 2225789004 2227530183 2228041661 468
22 3300042591 Ga0466692_192950 Ga0466692_192950_17759_19204 470
23 3300042656 Ga0466732_023507 Ga0466732_023507_28721_30136 471
24 3300042590 Ga0466690_080563 Ga0466690_080563_7236_8654 472
25 3300042599 Ga0466706_218375 Ga0466706_218375_37492_38943 472
26 3300042602 Ga0466713_043835 Ga0466713_043835_16630_18105 472
27 3300000062 IMNBL1DRAFT_c0001729 IMNBL1DRAFT_000172913 473
28 3300042619 Ga0466726_186310 Ga0466726_186310_270_1721 474
29 3300042591 Ga0466692_008888 Ga0466692_008888_22175_23698 475
30 3300042601 Ga0466707_229461 Ga0466707_229461_4603_6033 476
31 3300005083 Ga0068305_10112672 Ga0068305_101126725 477
32 3300042601 Ga0466707_159669 Ga0466707_159669_406346_407803 478
33 3300042602 Ga0466713_119808 Ga0466713_119808_15041_16489 482
34 3300042606 Ga0466719_429770 Ga0466719_429770_10549_11997 482
35 3300042612 Ga0466705_359873 Ga0466705_359873_11532_12980 482
36 3300042615 Ga0466711_221321 Ga0466711_221321_4740_6188 482
37 3300042616 Ga0466715_340014 Ga0466715_340014_5295_6743 482
38 3300042643 Ga0466704_137465 Ga0466704_137465_9212_10660 482
39 3300042652 Ga0466708_196684 Ga0466708_196684_9819_11267 482
40 iso_pr_bacteria 2830041218 2830042995 482
41 3300042590 Ga0466690_165942 Ga0466690_165942_34246_35697 483
42 3300042591 Ga0466692_063390 Ga0466692_063390_60705_62156 483
43 3300042599 Ga0466706_193089 Ga0466706_193089_35658_37109 483
44 3300042602 Ga0466713_016019 Ga0466713_016019_11374_12825 483
45 3300042602 Ga0466713_099964 Ga0466713_099964_10929_12380 483
46 3300042602 Ga0466713_129978 Ga0466713_129978_65623_67074 483
47 3300042602 Ga0466713_130991 Ga0466713_130991_121627_123078 483
48 3300042602 Ga0466713_140837 Ga0466713_140837_23260_24711 483
49 3300042609 Ga0466722_147385 Ga0466722_147385_2690_4141 483
50 3300042610 Ga0466698_454723 Ga0466698_454723_2292_3743 483
51 3300042612 Ga0466705_191266 Ga0466705_191266_12799_14250 483
52 3300042615 Ga0466711_241205 Ga0466711_241205_12972_14423 483
53 3300042616 Ga0466715_335119 Ga0466715_335119_10243_11694 483
54 3300042618 Ga0466723_344968 Ga0466723_344968_11617_13068 483
55 3300042621 Ga0466729_203041 Ga0466729_203041_5400_6851 483
56 3300042636 Ga0466703_288873 Ga0466703_288873_597_2048 483
57 3300042648 Ga0466709_056442 Ga0466709_056442_51749_53200 483
58 3300042652 Ga0466708_431015 Ga0466708_431015_15204_16655 483
59 3300042655 Ga0466727_148601 Ga0466727_148601_4433_5884 483
60 3300042659 Ga0466733_035306 Ga0466733_035306_77997_79448 483
61 3300042659 Ga0466733_201766 Ga0466733_201766_4789_6240 483
62 iso_pr_bacteria 2910926975 2910928929 483
63 iso_pr_bacteria 2910942425 2910945326 483
64 iso_pr_bacteria 2910949487 2910951202 483
65 iso_pr_bacteria 2910959314 2910960180 483
66 iso_pr_bacteria 2940193328 2940195400 483
67 iso_pr_bacteria 2940216256 2940217463 483
68 iso_pr_bacteria 2940244548 2940244926 483
69 iso_pr_bacteria 2940248789 2940249166 483
70 iso_pr_bacteria 2940253009 2940253108 483
71 iso_pr_bacteria 2940257232 2940257840 483
72 iso_pr_bacteria 2940336608 2940338674 483
73 3300000062 IMNBL1DRAFT_c0001589 IMNBL1DRAFT_00015896 484
74 3300005083 Ga0068305_10047479 Ga0068305_100474799 484
75 3300042593 Ga0466691_071799 Ga0466691_071799_15724_17178 484
76 3300042599 Ga0466706_233154 Ga0466706_233154_3006_4460 484
77 3300042605 Ga0466716_149833 Ga0466716_149833_24880_26334 484
78 3300042605 Ga0466716_333892 Ga0466716_333892_14659_16113 484
79 3300042615 Ga0466711_073849 Ga0466711_073849_1709_3163 484
80 3300042616 Ga0466715_233762 Ga0466715_233762_9134_10588 484
81 3300042618 Ga0466723_076286 Ga0466723_076286_4476_5930 484
82 iso_pr_bacteria 2922326829 2922329399 484
83 iso_pr_bacteria 3004672520 3004673872 484
84 iso_pr_bacteria 3004677695 3004679990 484
85 3300000062 IMNBL1DRAFT_c0009023 IMNBL1DRAFT_00090235 485
86 3300042596 Ga0466696_043628 Ga0466696_043628_12354_13811 485
87 3300042599 Ga0466706_002382 Ga0466706_002382_1468_2925 485
88 3300042602 Ga0466713_035486 Ga0466713_035486_9317_10774 485
89 3300042615 Ga0466711_196075 Ga0466711_196075_12484_13941 485
90 3300042643 Ga0466704_422764 Ga0466704_422764_10533_11990 485
91 3300042648 Ga0466709_197664 Ga0466709_197664_4058_5515 485
92 3300042659 Ga0466733_181724 Ga0466733_181724_25454_26911 485
93 3300056842 Ga0562377_0004 Ga0562377_0004_2302730_2304187 485
94 2225789004 2227544076 2228068158 486
95 3300010049 Ga0123356_10045025 Ga0123356_100450253 486
96 3300042596 Ga0466696_378568 Ga0466696_378568_1984_3444 486
97 3300042596 Ga0466696_410620 Ga0466696_410620_17618_19078 486
98 3300042612 Ga0466705_119745 Ga0466705_119745_3192_4652 486
99 3300042624 Ga0466735_082455 Ga0466735_082455_5710_7170 486
100 3300042643 Ga0466704_041870 Ga0466704_041870_2991_4451 486
101 3300042643 Ga0466704_139994 Ga0466704_139994_5262_6722 486
102 3300042643 Ga0466704_312751 Ga0466704_312751_5324_6784 486
103 3300042643 Ga0466704_320437 Ga0466704_320437_5386_6846 486
104 3300042659 Ga0466733_222052 Ga0466733_222052_63235_64695 486
105 iso_pr_bacteria 2940195863 2940196448 486
106 iso_pr_bacteria 2940205530 2940205955 486
107 iso_pr_bacteria 2940212447 2940212870 486
108 iso_pr_bacteria 2940298504 2940298927 486
109 iso_pr_bacteria 2940302308 2940303001 486
110 iso_pr_bacteria 2940306115 2940306411 486
111 iso_pr_bacteria 2940309933 2940309958 486
112 iso_pr_bacteria 2940313741 2940313766 486
113 iso_pr_bacteria 2940317558 2940317852 486
114 iso_pr_bacteria 2940321370 2940321395 486
115 iso_pr_bacteria 2940325180 2940325873 486
116 iso_pr_bacteria 2940328985 2940329679 486
117 iso_pr_bacteria 2940332795 2940333091 486
118 3300042603 Ga0466714_101275 Ga0466714_101275_58_1521 487
119 3300042643 Ga0466704_510642 Ga0466704_510642_3014_4477 487
120 3300042654 Ga0466725_054693 Ga0466725_054693_19071_20534 487
121 iso_pr_bacteria 2820757377 2820759788 487
122 iso_pr_bacteria 2940199050 2940200104 487
123 iso_pr_bacteria 2940346213 2940348344 487
124 3300005083 Ga0068305_10042196 Ga0068305_100421968 488
125 3300042612 Ga0466705_004521 Ga0466705_004521_4157_5623 488
126 3300042619 Ga0466726_079499 Ga0466726_079499_3569_5035 488
127 3300042636 Ga0466703_102327 Ga0466703_102327_15492_16958 488
128 3300042643 Ga0466704_602482 Ga0466704_602482_30508_31974 488
129 3300042654 Ga0466725_246022 Ga0466725_246022_17910_19376 488
130 iso_pr_bacteria 2940209341 2940211018 488
131 3300042602 Ga0466713_156423 Ga0466713_156423_14730_16199 489
132 3300042606 Ga0466719_042604 Ga0466719_042604_5555_7024 489
133 3300042616 Ga0466715_078929 Ga0466715_078929_21507_22976 489
134 3300042620 Ga0466728_226309 Ga0466728_226309_1349_2818 489
135 3300042636 Ga0466703_021603 Ga0466703_021603_18403_19872 489
136 3300042636 Ga0466703_162819 Ga0466703_162819_169_1677 489
137 3300042643 Ga0466704_174538 Ga0466704_174538_5956_7425 489
138 3300042652 Ga0466708_293328 Ga0466708_293328_40053_41522 489
139 2225789004 2227266896 2227714723 490
140 3300042593 Ga0466691_075210 Ga0466691_075210_5735_7207 490
141 3300042599 Ga0466706_088248 Ga0466706_088248_11937_13409 490
142 3300042619 Ga0466726_450811 Ga0466726_450811_915_2387 490
143 3300042603 Ga0466714_006756 Ga0466714_006756_20208_21683 491
144 iso_pr_bacteria 2923982719 2923985210 491
145 iso_pr_bacteria 2940202316 2940205415 491
146 3300042596 Ga0466696_025150 Ga0466696_025150_187_1668 493
147 3300042636 Ga0466703_395996 Ga0466703_395996_9558_11039 493
148 3300042596 Ga0466696_299474 Ga0466696_299474_16605_18089 494
149 3300042603 Ga0466714_051125 Ga0466714_051125_44871_46364 497
150 3300042656 Ga0466732_080661 Ga0466732_080661_2226_3719 497
151 3300042601 Ga0466707_137968 Ga0466707_137968_15796_17307 503
152 3300042601 Ga0466707_272065 Ga0466707_272065_611_2122 503
153 3300042618 Ga0466723_276908 Ga0466723_276908_4436_5971 511
154 3300042659 Ga0466733_146065 Ga0466733_146065_3420_5003 511
155 iso_pr_bacteria 2820776227 2820778421 513
156 3300009784 Ga0123357_10053426 Ga0123357_100534266 514
157 3300042596 Ga0466696_185074 Ga0466696_185074_102_1688 515
158 iso_pr_bacteria 2820789850 2820790374 521
159 3300042596 Ga0466696_048763 Ga0466696_048763_3662_5233 523

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02875 Mur_ligase_C Mur ligase, glutamate ligase domain 365 495 0.95
PF08245 Mur_ligase_M Mur ligase middle domain 147 343 0.93
PF01225 Mur_ligase Mur ligase family, catalytic domain 22 82 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.