Protein Family IF05103

Metagenome Isolate
214 Members
81 Samples
184 Scaffolds
386.02 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_033403|Ga0466696_033403_636_1868
Length
410 aa
Sequence
MFALKPVKLVMNTDNSTYNFDDIRPLNDNEVRDAIESLLRSADFRSALRYIMPDLDWEEFANAMRRCKTKSQFKTTLAYNAVIQIAKMTTFSLTISGRSRAPRETIPCTFISNHRDIVLDAAFLNVLLFEIGREMTQVAIGDNLLIHPWIDTLVRLNNCFIVKRALSVRQLLEASRQLSAYIHHTIKRSGESIWIAQREGRAKDSNDHTQSSILKMLNMAGDDKDSILKNLMSLNIVPIAISYEHDPCDYLKAKEFQQKRDDSDFVKSKRDDLLNMETGLLNNKGRVHFTIGSPINDKLARLEYKKSDRNALIAAIAEIIDKEIYKHYRFYPCNYVAYDLLHHSVYFRTNYDLRDKMLFETYLQKQIDKIDLPNKDERFLRTKILEMYSNPLQNHLDNVGQTTSNGEDGE

📊 Sample Types

Isolate 14.0%
Metagenome 86.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 33.8%
Termitidae 27.5%
Kalotermitidae 17.5%
Unclassified 6.2%
Termopsidae 5.0%
Rhinotermitidae 5.0%
Passalidae 3.8%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 209
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
2 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
3 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
4 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
5 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
6 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
10 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
11 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
12 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
15 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
16 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
17 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
27 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
28 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
29 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
30 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
31 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
35 2923982719 Parabacteroides sp. 52 Isolate Blattidae
36 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
37 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
38 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
39 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
44 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
45 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
46 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
47 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
48 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
51 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
52 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
53 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
54 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
55 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
56 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
57 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
58 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
59 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
60 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
61 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
62 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
63 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
64 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
65 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
66 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
67 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
68 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
69 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
70 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
71 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
72 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
73 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
74 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
75 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
76 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
77 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
78 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
79 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
80 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
81 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_078806 3300042659 Bacteria 7143
2 Ga0466733_081782 3300042659 Bacteria 22829
3 2227261351 2225789004 Bacteria 7006
4 Ga0068302_10168767 3300005071 Bacteria 3729
5 Ga0466715_056557 3300042616 Bacteria 7288
6 Ga0466715_118092 3300042616 Bacteria 13081
7 Ga0466726_311948 3300042619 Bacteria 5377
8 Ga0466690_037512 3300042590 Bacteria 4211
9 Ga0466692_155733 3300042591 Bacteria 3425
10 Ga0466691_060692 3300042593 Bacteria 22870
11 Ga0466696_033403 3300042596 Bacteria 5157
12 Ga0466696_077671 3300042596 Bacteria 18917
13 Ga0466696_164484 3300042596 Bacteria 3472
14 Ga0466706_179743 3300042599 Bacteria 3206
15 Ga0466714_016102 3300042603 Bacteria 35564
16 Ga0466719_113132 3300042606 Bacteria 2524
17 Ga0123353_10156837 3300010167 Bacteria 3627
18 Ga0466735_042391 3300042624 Bacteria 2353
19 Ga0466704_100291 3300042643 Bacteria 27866
20 Ga0466704_106814 3300042643 Bacteria 18291
21 Ga0466724_41607 3300042649 Bacteria 1531
22 Ga0466705_143850 3300042612 Bacteria 38978
23 Ga0466733_119479 3300042659 Unclassified 3875
24 JGI24702J35022_10036670 3300002462 Bacteria 2620
25 Ga0068305_10074356 3300005083 Bacteria 7825
26 Ga0466711_298539 3300042615 Bacteria 5772
27 Ga0466715_066831 3300042616 Bacteria 11732
28 Ga0466729_095620 3300042621 Bacteria 5430
29 Ga0466690_077926 3300042590 Bacteria 4747
30 Ga0466690_172738 3300042590 Bacteria 57212
31 Ga0466693_055865 3300042592 Bacteria 2634
32 Ga0466696_043446 3300042596 Bacteria 10091
33 Ga0466696_198573 3300042596 Unclassified 3746
34 Ga0466696_323500 3300042596 Bacteria 24747
35 Ga0466696_489357 3300042596 Bacteria 8948
36 Ga0466699_358518 3300042597 Bacteria 2031
37 Ga0466713_096596 3300042602 Bacteria 406546
38 Ga0466719_186573 3300042606 Bacteria 15608
39 Ga0466722_204921 3300042609 Bacteria 21464
40 Ga0466703_101237 3300042636 Bacteria 13083
41 Ga0466703_165459 3300042636 Bacteria 12745
42 Ga0466703_177352 3300042636 Bacteria 30164
43 Ga0466703_253790 3300042636 Bacteria 12991
44 Ga0466704_035232 3300042643 Bacteria 3094
45 Ga0466704_236040 3300042643 Bacteria 23395
46 Ga0466727_023845 3300042655 Bacteria 16909
47 Ga0466727_265103 3300042655 Bacteria 3692
48 2227069681 2225789003 Bacteria 13597
49 2227280803 2225789004 Bacteria 6812
50 JGI24702J35022_10006117 3300002462 Bacteria 6986
51 Ga0466710_206891 3300042613 Bacteria 2667
52 Ga0466715_043219 3300042616 Bacteria 25123
53 Ga0466728_391319 3300042620 Bacteria 47879
54 Ga0466694_211572 3300042594 Bacteria 1793
55 Ga0466700_103876 3300042600 Bacteria 3235
56 Ga0466707_111993 3300042601 Bacteria 11357
57 Ga0466707_224834 3300042601 Bacteria 36207
58 Ga0466713_022498 3300042602 Bacteria 83235
59 Ga0466714_046181 3300042603 Bacteria 4010
60 Ga0466716_175138 3300042605 Bacteria 7946
61 Ga0466716_434229 3300042605 Bacteria 25603
62 Ga0466722_254598 3300042609 Bacteria 13326
63 Ga0466735_080453 3300042624 Bacteria 2631
64 Ga0466703_174239 3300042636 Bacteria 11289
65 Ga0466709_096536 3300042648 Bacteria 31729
66 Ga0466705_119312 3300042612 Bacteria 10871
67 IMNBL1DRAFT_c0002430 3300000062 Bacteria 12970
68 IMNBL1DRAFT_c0004630 3300000062 Bacteria 8182
69 IMNBL1DRAFT_c0006767 3300000062 Bacteria 6188
70 JGI24702J35022_10000052 3300002462 Bacteria 49045
71 JGI24702J35022_10035083 3300002462 Bacteria 2683
72 Ga0068305_10058805 3300005083 Bacteria 8168
73 Ga0466706_156084 3300042599 Bacteria 15343
74 Ga0466707_312039 3300042601 Bacteria 9254
75 Ga0466713_061704 3300042602 Bacteria 58940
76 Ga0466714_050034 3300042603 Bacteria 52077
77 Ga0466719_072882 3300042606 Bacteria 12516
78 Ga0123356_10060808 3300010049 Bacteria 3526
79 Ga0123356_10097015 3300010049 Bacteria 2820
80 Ga0123353_10243962 3300010167 Bacteria 2789
81 Ga0466735_087403 3300042624 Bacteria 2503
82 Ga0466704_230455 3300042643 Bacteria 5728
83 Ga0466704_230588 3300042643 Bacteria 2605
84 Ga0466704_272694 3300042643 Bacteria 11548
85 Ga0466704_556669 3300042643 Bacteria 7941
86 Ga0466725_021276 3300042654 Bacteria 24418
87 Ga0466705_025497 3300042612 Bacteria 5436
88 Ga0466705_029661 3300042612 Bacteria 15539
89 Ga0466705_350213 3300042612 Bacteria 6932
90 Ga0466733_019214 3300042659 Bacteria 126944
91 JGI24702J35022_10008385 3300002462 Bacteria 5851
92 JGI24696J40584_12961200 3300002834 Bacteria 11946
93 Ga0068302_10519094 3300005071 Bacteria 2089
94 Ga0068305_10220623 3300005083 Bacteria 1555
95 Ga0466711_061436 3300042615 Bacteria 1150
96 Ga0466711_263178 3300042615 Bacteria 12410
97 Ga0466715_080963 3300042616 Bacteria 6536
98 Ga0466715_109224 3300042616 Bacteria 75833
99 Ga0466723_031578 3300042618 Bacteria 25603
100 Ga0466693_235215 3300042592 Bacteria 1585
101 Ga0466696_216658 3300042596 Bacteria 10942
102 Ga0466696_288691 3300042596 Bacteria 66943
103 Ga0466700_005502 3300042600 Bacteria 2038
104 Ga0466707_168419 3300042601 Bacteria 12239
105 Ga0466713_037297 3300042602 Bacteria 10325
106 Ga0466713_048054 3300042602 Bacteria 2648
107 Ga0466714_006756 3300042603 Bacteria 211810
108 Ga0466716_015499 3300042605 Bacteria 12805
109 Ga0466722_021094 3300042609 Bacteria 6705
110 Ga0466722_022507 3300042609 Bacteria 12182
111 Ga0466735_054151 3300042624 Bacteria 3594
112 Ga0466709_305019 3300042648 Bacteria 2983
113 Ga0466705_005120 3300042612 Bacteria 3934
114 Ga0466733_030455 3300042659 Bacteria 39544
115 IMNBL1DRAFT_c0006180 3300000062 Bacteria 6604
116 JGI24705J35276_12238770 3300002504 Bacteria 57808
117 JGI24699J35502_11131956 3300002509 Bacteria 6213
118 Ga0072940_1369425 3300005200 Bacteria 1670
119 Ga0466710_247932 3300042613 Bacteria 1908
120 Ga0466723_059005 3300042618 Bacteria 62633
121 Ga0466728_399396 3300042620 Bacteria 7766
122 Ga0466729_089960 3300042621 Bacteria 9721
123 Ga0466693_373242 3300042592 Bacteria 1950
124 Ga0466695_155412 3300042595 Bacteria 5015
125 Ga0466707_265105 3300042601 Bacteria 17266
126 Ga0466713_143155 3300042602 Bacteria 188721
127 Ga0466714_034472 3300042603 Bacteria 3587
128 Ga0466716_023288 3300042605 Bacteria 6855
129 Ga0466735_063936 3300042624 Bacteria 5662
130 Ga0466735_175797 3300042624 Bacteria 2786
131 Ga0466704_228006 3300042643 Bacteria 10392
132 Ga0466725_205673 3300042654 Bacteria 4900
133 Ga0466727_001589 3300042655 Bacteria 4634
134 Ga0466705_078038 3300042612 Bacteria 10688
135 Ga0466733_055799 3300042659 Bacteria 106016
136 IMNBL1DRAFT_c0007061 3300000062 Bacteria 5983
137 IMNBL1DRAFT_c0017657 3300000062 Unclassified 2992
138 JGI24702J35022_10030978 3300002462 Bacteria 2868
139 JGI24702J35022_10140269 3300002462 Bacteria 1348
140 Ga0068302_10086754 3300005071 Unclassified 5793
141 Ga0072941_1437251 3300005201 Bacteria 1585
142 Ga0466710_240323 3300042613 Bacteria 19088
143 Ga0466715_015022 3300042616 Bacteria 20053
144 Ga0466718_142578 3300042617 Bacteria 1935
145 Ga0466726_001708 3300042619 Bacteria 2117
146 Ga0466728_142087 3300042620 Bacteria 16905
147 Ga0466656_218669 3300042550 Bacteria 33170
148 Ga0466690_226779 3300042590 Bacteria 21131
149 Ga0466690_342711 3300042590 Bacteria 6247
150 Ga0466691_124508 3300042593 Bacteria 35460
151 Ga0466706_264655 3300042599 Bacteria 11685
152 Ga0466707_050302 3300042601 Bacteria 3601
153 Ga0466713_024971 3300042602 Bacteria 11465
154 Ga0466719_036510 3300042606 Bacteria 25328
155 Ga0466722_117304 3300042609 Bacteria 122884
156 Ga0123354_10000565 3300010882 Bacteria 38228
157 Ga0466731_310822 3300042622 Bacteria 3222
158 Ga0466730_011350 3300042625 Bacteria 3523
159 Ga0466704_283483 3300042643 Bacteria 4787
160 Ga0466733_203254 3300042659 Bacteria 17585
161 2227153022 2225789004 Bacteria 8525
162 2227557978 2225789004 Bacteria 2760
163 JGI24702J35022_10035077 3300002462 Bacteria 2683
164 Ga0072941_1644237 3300005201 Bacteria 2692
165 Ga0466711_241851 3300042615 Bacteria 11602
166 Ga0466715_017736 3300042616 Bacteria 12115
167 Ga0466723_199680 3300042618 Bacteria 21029
168 Ga0466723_223624 3300042618 Bacteria 21568
169 Ga0466726_072101 3300042619 Bacteria 6736
170 Ga0466692_050403 3300042591 Bacteria 54496
171 Ga0466691_049926 3300042593 Bacteria 11408
172 Ga0466696_124796 3300042596 Bacteria 1738
173 Ga0466696_322323 3300042596 Bacteria 4419
174 Ga0466713_020955 3300042602 Bacteria 68417
175 Ga0466713_156458 3300042602 Bacteria 4963
176 Ga0466716_121228 3300042605 Bacteria 19334
177 Ga0466703_098605 3300042636 Bacteria 6901
178 Ga0466703_151143 3300042636 Bacteria 15053
179 Ga0466703_164140 3300042636 Bacteria 13651
180 Ga0466704_241136 3300042643 Bacteria 12160
181 Ga0466709_026484 3300042648 Unclassified 13139
182 Ga0466708_171823 3300042652 Bacteria 8339
183 Ga0466725_061742 3300042654 Bacteria 7539
184 Ga0466727_008747 3300042655 Bacteria 11688

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_061436 Ga0466711_061436_76_1080 334
2 3300042636 Ga0466703_165459 Ga0466703_165459_3537_4583 348
3 3300042612 Ga0466705_078038 Ga0466705_078038_2772_3941 358
4 3300042593 Ga0466691_060692 Ga0466691_060692_7247_8419 360
5 3300042643 Ga0466704_230455 Ga0466704_230455_1324_2496 363
6 3300042624 Ga0466735_042391 Ga0466735_042391_882_2039 367
7 3300042602 Ga0466713_022498 Ga0466713_022498_3269_4417 368
8 3300042643 Ga0466704_556669 Ga0466704_556669_6654_7823 371
9 3300042609 Ga0466722_117304 Ga0466722_117304_6448_7611 372
10 3300042643 Ga0466704_106814 Ga0466704_106814_4402_5571 373
11 3300042596 Ga0466696_216658 Ga0466696_216658_7468_8601 377
12 3300042652 Ga0466708_171823 Ga0466708_171823_6257_7393 378
13 3300042649 Ga0466724_41607 Ga0466724_41607_130_1269 379
14 3300042601 Ga0466707_168419 Ga0466707_168419_5812_6954 380
15 3300042613 Ga0466710_240323 Ga0466710_240323_14117_15259 380
16 3300002834 JGI24696J40584_12961200 JGI24696J40584_129612004 381
17 3300005201 Ga0072941_1644237 Ga0072941_16442371 381
18 3300042590 Ga0466690_342711 Ga0466690_342711_4784_5929 381
19 3300042595 Ga0466695_155412 Ga0466695_155412_24_1169 381
20 3300042616 Ga0466715_118092 Ga0466715_118092_10096_11241 381
21 3300042622 Ga0466731_310822 Ga0466731_310822_888_2033 381
22 3300042654 Ga0466725_061742 Ga0466725_061742_775_1920 381
23 3300002462 JGI24702J35022_10035077 JGI24702J35022_100350773 382
24 3300042602 Ga0466713_061704 Ga0466713_061704_32892_34040 382
25 3300042602 Ga0466713_143155 Ga0466713_143155_2733_3881 382
26 3300042602 Ga0466713_156458 Ga0466713_156458_3370_4518 382
27 3300042612 Ga0466705_350213 Ga0466705_350213_2307_3455 382
28 3300042616 Ga0466715_080963 Ga0466715_080963_3706_4854 382
29 3300042621 Ga0466729_095620 Ga0466729_095620_91_1239 382
30 3300042625 Ga0466730_011350 Ga0466730_011350_2079_3227 382
31 3300042636 Ga0466703_177352 Ga0466703_177352_8351_9499 382
32 3300042648 Ga0466709_026484 Ga0466709_026484_9086_10234 382
33 3300042659 Ga0466733_019214 Ga0466733_019214_83444_84592 382
34 3300042659 Ga0466733_119479 Ga0466733_119479_460_1608 382
35 3300042659 Ga0466733_203254 Ga0466733_203254_10128_11276 382
36 iso_pr_bacteria 2695420314 2695470649 382
37 iso_pr_bacteria 2910942425 2910945133 382
38 iso_pr_bacteria 2910959314 2910961136 382
39 iso_pr_bacteria 2940244548 2940245922 382
40 iso_pr_bacteria 2940248789 2940249746 382
41 iso_pr_bacteria 2940253009 2940253821 382
42 iso_pr_bacteria 2940257232 2940257988 382
43 iso_pr_bacteria 8100166142 8100168680 382
44 3300000062 IMNBL1DRAFT_c0007061 IMNBL1DRAFT_00070616 383
45 3300000062 IMNBL1DRAFT_c0017657 IMNBL1DRAFT_00176573 383
46 3300042591 Ga0466692_050403 Ga0466692_050403_18430_19581 383
47 3300042596 Ga0466696_322323 Ga0466696_322323_3212_4363 383
48 3300042601 Ga0466707_265105 Ga0466707_265105_7398_8549 383
49 3300042603 Ga0466714_034472 Ga0466714_034472_1879_3030 383
50 3300042620 Ga0466728_391319 Ga0466728_391319_12896_14047 383
51 3300042624 Ga0466735_063936 Ga0466735_063936_1719_2870 383
52 3300042624 Ga0466735_175797 Ga0466735_175797_556_1707 383
53 iso_pr_bacteria 2695420931 2698110937 383
54 3300042603 Ga0466714_046181 Ga0466714_046181_1424_2578 384
55 3300042603 Ga0466714_050034 Ga0466714_050034_19243_20397 384
56 3300042619 Ga0466726_001708 Ga0466726_001708_515_1669 384
57 3300042624 Ga0466735_054151 Ga0466735_054151_415_1569 384
58 3300042636 Ga0466703_174239 Ga0466703_174239_3636_4790 384
59 iso_pr_bacteria 2910930387 2910931381 384
60 3300002504 JGI24705J35276_12238770 JGI24705J35276_1223877012 385
61 3300005083 Ga0068305_10220623 Ga0068305_102206231 385
62 3300042590 Ga0466690_226779 Ga0466690_226779_12225_13382 385
63 3300042592 Ga0466693_055865 Ga0466693_055865_1228_2385 385
64 3300042599 Ga0466706_179743 Ga0466706_179743_89_1246 385
65 3300042603 Ga0466714_006756 Ga0466714_006756_136399_137556 385
66 3300042621 Ga0466729_089960 Ga0466729_089960_3907_5064 385
67 3300042624 Ga0466735_080453 Ga0466735_080453_1014_2171 385
68 3300005200 Ga0072940_1369425 Ga0072940_13694251 386
69 3300010167 Ga0123353_10243962 Ga0123353_102439622 386
70 3300042591 Ga0466692_155733 Ga0466692_155733_189_1349 386
71 3300042592 Ga0466693_235215 Ga0466693_235215_307_1467 386
72 3300042593 Ga0466691_124508 Ga0466691_124508_26441_27601 386
73 3300042596 Ga0466696_043446 Ga0466696_043446_3447_4607 386
74 3300042599 Ga0466706_156084 Ga0466706_156084_11871_13031 386
75 3300042601 Ga0466707_111993 Ga0466707_111993_5907_7067 386
76 3300042602 Ga0466713_096596 Ga0466713_096596_251993_253153 386
77 3300042603 Ga0466714_016102 Ga0466714_016102_21084_22244 386
78 3300042606 Ga0466719_186573 Ga0466719_186573_9976_11136 386
79 3300042609 Ga0466722_021094 Ga0466722_021094_4524_5684 386
80 3300042609 Ga0466722_204921 Ga0466722_204921_1516_2676 386
81 3300042612 Ga0466705_025497 Ga0466705_025497_3289_4449 386
82 iso_pr_bacteria 2940202316 2940204169 386
83 2225789004 2227557978 2228092764 387
84 3300010882 Ga0123354_10000565 Ga0123354_100005659 387
85 3300042594 Ga0466694_211572 Ga0466694_211572_36_1199 387
86 3300042596 Ga0466696_124796 Ga0466696_124796_208_1371 387
87 3300042596 Ga0466696_288691 Ga0466696_288691_34372_35535 387
88 3300042602 Ga0466713_020955 Ga0466713_020955_58200_59363 387
89 3300042602 Ga0466713_024971 Ga0466713_024971_6809_7972 387
90 3300042602 Ga0466713_037297 Ga0466713_037297_7692_8855 387
91 3300042605 Ga0466716_023288 Ga0466716_023288_3266_4429 387
92 3300042609 Ga0466722_254598 Ga0466722_254598_1881_3044 387
93 3300042612 Ga0466705_029661 Ga0466705_029661_6401_7564 387
94 3300042616 Ga0466715_015022 Ga0466715_015022_9814_10977 387
95 3300042620 Ga0466728_142087 Ga0466728_142087_3726_4889 387
96 3300042624 Ga0466735_087403 Ga0466735_087403_84_1247 387
97 3300042636 Ga0466703_253790 Ga0466703_253790_10871_12034 387
98 3300042643 Ga0466704_035232 Ga0466704_035232_1014_2177 387
99 3300042643 Ga0466704_100291 Ga0466704_100291_7304_8467 387
100 3300042643 Ga0466704_241136 Ga0466704_241136_358_1521 387
101 3300042643 Ga0466704_272694 Ga0466704_272694_6885_8048 387
102 3300042643 Ga0466704_283483 Ga0466704_283483_3267_4430 387
103 3300042654 Ga0466725_021276 Ga0466725_021276_17726_18889 387
104 3300042659 Ga0466733_030455 Ga0466733_030455_36575_37738 387
105 3300042659 Ga0466733_081782 Ga0466733_081782_7517_8680 387
106 iso_pr_bacteria 2940205530 2940208070 387
107 iso_pr_bacteria 2940212447 2940215000 387
108 iso_pr_bacteria 2940298504 2940301054 387
109 iso_pr_bacteria 2940302308 2940304841 387
110 iso_pr_bacteria 2940306115 2940308543 387
111 iso_pr_bacteria 2940309933 2940312397 387
112 iso_pr_bacteria 2940313741 2940316209 387
113 iso_pr_bacteria 2940317558 2940320025 387
114 iso_pr_bacteria 2940321370 2940323780 387
115 iso_pr_bacteria 2940325180 2940327727 387
116 iso_pr_bacteria 2940328985 2940331517 387
117 iso_pr_bacteria 2940332795 2940335261 387
118 2225789003 2227069681 2227430397 388
119 2225789004 2227153022 2227559580 388
120 2225789004 2227280803 2227732667 388
121 3300000062 IMNBL1DRAFT_c0002430 IMNBL1DRAFT_00024303 388
122 3300002462 JGI24702J35022_10000052 JGI24702J35022_1000005219 388
123 3300002462 JGI24702J35022_10036670 JGI24702J35022_100366702 388
124 3300005071 Ga0068302_10168767 Ga0068302_101687674 388
125 3300005083 Ga0068305_10058805 Ga0068305_100588056 388
126 3300005083 Ga0068305_10074356 Ga0068305_100743567 388
127 3300042550 Ga0466656_218669 Ga0466656_218669_2748_3914 388
128 3300042590 Ga0466690_077926 Ga0466690_077926_3247_4413 388
129 3300042593 Ga0466691_049926 Ga0466691_049926_3715_4881 388
130 3300042605 Ga0466716_175138 Ga0466716_175138_1009_2175 388
131 3300042605 Ga0466716_434229 Ga0466716_434229_14216_15382 388
132 3300042612 Ga0466705_005120 Ga0466705_005120_359_1525 388
133 3300042613 Ga0466710_206891 Ga0466710_206891_581_1747 388
134 3300042615 Ga0466711_263178 Ga0466711_263178_3062_4228 388
135 3300042615 Ga0466711_298539 Ga0466711_298539_2983_4149 388
136 3300042616 Ga0466715_043219 Ga0466715_043219_13286_14452 388
137 3300042616 Ga0466715_109224 Ga0466715_109224_55184_56350 388
138 3300042620 Ga0466728_399396 Ga0466728_399396_1217_2383 388
139 3300042636 Ga0466703_098605 Ga0466703_098605_4256_5422 388
140 3300042636 Ga0466703_101237 Ga0466703_101237_4607_5773 388
141 3300042636 Ga0466703_164140 Ga0466703_164140_3746_4912 388
142 3300042643 Ga0466704_236040 Ga0466704_236040_3388_4554 388
143 3300042648 Ga0466709_305019 Ga0466709_305019_678_1844 388
144 iso_pr_bacteria 2910926975 2910929447 388
145 iso_pr_bacteria 2923982719 2923983902 388
146 iso_pr_bacteria 2940371297 2940373121 388
147 3300000062 IMNBL1DRAFT_c0004630 IMNBL1DRAFT_00046304 389
148 3300000062 IMNBL1DRAFT_c0006180 IMNBL1DRAFT_00061803 389
149 3300002462 JGI24702J35022_10008385 JGI24702J35022_100083853 389
150 3300002462 JGI24702J35022_10030978 JGI24702J35022_100309782 389
151 3300005071 Ga0068302_10519094 Ga0068302_105190942 389
152 3300010167 Ga0123353_10156837 Ga0123353_101568372 389
153 3300042596 Ga0466696_077671 Ga0466696_077671_10356_11525 389
154 3300042596 Ga0466696_198573 Ga0466696_198573_1096_2265 389
155 3300042597 Ga0466699_358518 Ga0466699_358518_72_1241 389
156 3300042600 Ga0466700_103876 Ga0466700_103876_895_2064 389
157 3300042601 Ga0466707_312039 Ga0466707_312039_5760_6929 389
158 3300042606 Ga0466719_036510 Ga0466719_036510_23843_25012 389
159 3300042606 Ga0466719_072882 Ga0466719_072882_8086_9255 389
160 3300042606 Ga0466719_113132 Ga0466719_113132_529_1698 389
161 3300042612 Ga0466705_119312 Ga0466705_119312_8602_9771 389
162 3300042612 Ga0466705_143850 Ga0466705_143850_31687_32856 389
163 3300042615 Ga0466711_241851 Ga0466711_241851_4026_5195 389
164 3300042616 Ga0466715_017736 Ga0466715_017736_7545_8714 389
165 3300042616 Ga0466715_056557 Ga0466715_056557_2225_3394 389
166 3300042616 Ga0466715_066831 Ga0466715_066831_2812_3981 389
167 3300042618 Ga0466723_199680 Ga0466723_199680_6572_7741 389
168 3300042619 Ga0466726_072101 Ga0466726_072101_2421_3590 389
169 3300042619 Ga0466726_311948 Ga0466726_311948_3718_4887 389
170 3300042643 Ga0466704_228006 Ga0466704_228006_2525_3694 389
171 3300042654 Ga0466725_205673 Ga0466725_205673_3201_4370 389
172 3300042655 Ga0466727_001589 Ga0466727_001589_2429_3598 389
173 3300042659 Ga0466733_055799 Ga0466733_055799_50765_51934 389
174 3300042659 Ga0466733_078806 Ga0466733_078806_1589_2758 389
175 iso_pr_bacteria 2940199050 2940201311 389
176 iso_pr_bacteria 2940209341 2940210586 389
177 iso_pr_bacteria 2940346213 2940347578 389
178 3300000062 IMNBL1DRAFT_c0006767 IMNBL1DRAFT_00067678 390
179 3300002509 JGI24699J35502_11131956 JGI24699J35502_111319563 390
180 3300005071 Ga0068302_10086754 Ga0068302_100867542 390
181 3300042590 Ga0466690_037512 Ga0466690_037512_2345_3517 390
182 3300042590 Ga0466690_172738 Ga0466690_172738_19595_20767 390
183 3300042596 Ga0466696_489357 Ga0466696_489357_4343_5515 390
184 3300042601 Ga0466707_050302 Ga0466707_050302_1516_2688 390
185 3300042605 Ga0466716_015499 Ga0466716_015499_7150_8322 390
186 3300042605 Ga0466716_121228 Ga0466716_121228_6973_8145 390
187 3300042613 Ga0466710_247932 Ga0466710_247932_216_1388 390
188 3300042618 Ga0466723_059005 Ga0466723_059005_43078_44250 390
189 3300042618 Ga0466723_223624 Ga0466723_223624_12766_13938 390
190 3300042643 Ga0466704_230588 Ga0466704_230588_1391_2563 390
191 3300042648 Ga0466709_096536 Ga0466709_096536_25298_26470 390
192 iso_pr_bacteria 2940195863 2940196469 390
193 2225789004 2227261351 2227707578 391
194 3300005201 Ga0072941_1437251 Ga0072941_14372512 391
195 3300042592 Ga0466693_373242 Ga0466693_373242_733_1908 391
196 3300042596 Ga0466696_323500 Ga0466696_323500_13294_14469 391
197 3300042617 Ga0466718_142578 Ga0466718_142578_348_1523 391
198 3300042618 Ga0466723_031578 Ga0466723_031578_5607_6782 391
199 3300002462 JGI24702J35022_10140269 JGI24702J35022_101402692 392
200 3300042599 Ga0466706_264655 Ga0466706_264655_8981_10159 392
201 3300042602 Ga0466713_048054 Ga0466713_048054_1005_2183 392
202 3300042655 Ga0466727_023845 Ga0466727_023845_8725_9903 392
203 3300042609 Ga0466722_022507 Ga0466722_022507_3585_4766 393
204 3300002462 JGI24702J35022_10035083 JGI24702J35022_100350832 394
205 3300010049 Ga0123356_10097015 Ga0123356_100970152 396
206 3300042596 Ga0466696_164484 Ga0466696_164484_1458_2651 397
207 3300042655 Ga0466727_008747 Ga0466727_008747_5558_6751 397
208 3300042600 Ga0466700_005502 Ga0466700_005502_311_1510 399
209 3300042601 Ga0466707_224834 Ga0466707_224834_23237_24436 399
210 3300042655 Ga0466727_265103 Ga0466727_265103_690_1889 399
211 3300002462 JGI24702J35022_10006117 JGI24702J35022_100061173 401
212 3300042636 Ga0466703_151143 Ga0466703_151143_7176_8381 401
213 3300010049 Ga0123356_10060808 Ga0123356_100608082 402
214 3300042596 Ga0466696_033403 Ga0466696_033403_636_1868 410

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01553 Acyltransferase Acyltransferase 96 205 0.72

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01553 GO:0016746 acyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.