Protein Family IF05101

Metagenome Isolate
154 Members
47 Samples
146 Scaffolds
87.48 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_031445|Ga0466696_031445_2992_3300
Length
102 aa
Sequence
VELYGSYDPGEAGKNMKILEVKDVTRKDVPIYYRRFYTGIAVMELINKTVEAVIDFSIEIKPTGPKEILINFLDKVDYPLIPLKKELKDLLDRMDSTGELPV

📊 Sample Types

Isolate 5.2%
Metagenome 94.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.6%
Kalotermitidae 31.8%
Unclassified 20.5%
Termopsidae 6.8%
Rhinotermitidae 2.3%

🌳 Taxonomy

Archaea 1
Bacteria 146
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
11 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
12 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
20 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
21 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
22 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
23 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
35 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
41 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
43 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_352220 3300042656 Unclassified 3304
2 Ga0466704_011268 3300042643 Bacteria 25139
3 Ga0466704_118862 3300042643 Bacteria 16675
4 Ga0466704_473977 3300042643 Bacteria 23964
5 Ga0466692_154744 3300042591 Bacteria 5993
6 Ga0466693_303364 3300042592 Bacteria 5038
7 Ga0466694_289868 3300042594 Bacteria 1509
8 Ga0466699_080963 3300042597 Bacteria 1417
9 Ga0466699_262757 3300042597 Bacteria 2410
10 Ga0466699_334582 3300042597 Unclassified 5483
11 Ga0466699_444056 3300042597 Bacteria 8338
12 Ga0466720_217810 3300042607 Bacteria 9912
13 Ga0466715_148323 3300042616 Bacteria 3793
14 Ga0466723_252971 3300042618 Bacteria 1183
15 Ga0466726_034345 3300042619 Bacteria 17460
16 Ga0466728_235690 3300042620 Bacteria 8626
17 JGI24698J34947_10298966 3300002449 Bacteria 581
18 JGI24695J34938_10007648 3300002450 Bacteria 6281
19 Ga0074263_101332 3300005485 Bacteria 1877
20 Ga0466732_206748 3300042656 Bacteria 33874
21 Ga0466703_048944 3300042636 Bacteria 1086
22 Ga0466692_083091 3300042591 Bacteria 2359
23 Ga0466692_116465 3300042591 Bacteria 19396
24 Ga0466696_233847 3300042596 Bacteria 11876
25 Ga0466696_255031 3300042596 Unclassified 2143
26 Ga0466696_279796 3300042596 Unclassified 2106
27 Ga0466711_094892 3300042615 Bacteria 21125
28 Ga0466726_063115 3300042619 Bacteria 1308
29 Ga0123353_10907966 3300010167 Bacteria 1198
30 JGI24695J34938_10051124 3300002450 Bacteria 1810
31 Ga0466732_133919 3300042656 Unclassified 1024
32 Ga0466703_099911 3300042636 Bacteria 4123
33 Ga0466704_237034 3300042643 Bacteria 17852
34 Ga0466709_418869 3300042648 Bacteria 3404
35 Ga0466708_093813 3300042652 Bacteria 1428
36 Ga0466727_098262 3300042655 Bacteria 4210
37 Ga0264413_108977 3300024493 Bacteria 3330
38 Ga0466693_096673 3300042592 Unclassified 6469
39 Ga0466694_031771 3300042594 Bacteria 1217
40 Ga0466713_143214 3300042602 Bacteria 1560
41 Ga0466719_470329 3300042606 Bacteria 5862
42 Ga0466720_022123 3300042607 Bacteria 1194
43 Ga0466715_021799 3300042616 Bacteria 20987
44 Ga0466715_252975 3300042616 Bacteria 10555
45 Ga0466723_105234 3300042618 Bacteria 9521
46 Ga0123355_10008175 3300009826 Bacteria 15799
47 AustNasuHG_c1010155 3300000089 Bacteria 3286
48 JGI24698J34947_10030734 3300002449 Bacteria 2831
49 JGI24695J34938_10022191 3300002450 Bacteria 3088
50 JGI24695J34938_10052352 3300002450 Bacteria 1781
51 JGI24695J34938_10126587 3300002450 Bacteria 1041
52 Ga0072941_1046872 3300005201 Bacteria 6109
53 Ga0466705_003616 3300042612 Bacteria 15625
54 Ga0466703_244349 3300042636 Bacteria 13637
55 Ga0466704_239661 3300042643 Bacteria 53688
56 Ga0466692_138087 3300042591 Bacteria 1032
57 Ga0466693_405235 3300042592 Bacteria 9545
58 Ga0466691_155341 3300042593 Bacteria 8143
59 Ga0466696_279885 3300042596 Bacteria 1388
60 Ga0466696_437602 3300042596 Bacteria 12376
61 Ga0466699_004462 3300042597 Bacteria 57714
62 Ga0466699_234122 3300042597 Bacteria 1198
63 Ga0466699_263841 3300042597 Bacteria 3202
64 Ga0466699_293350 3300042597 Bacteria 11047
65 Ga0466699_355360 3300042597 Bacteria 2273
66 Ga0466719_149280 3300042606 Bacteria 6009
67 Ga0123355_10147440 3300009826 Bacteria 3584
68 Ga0123356_10001613 3300010049 Bacteria 24733
69 Ga0123356_10002113 3300010049 Bacteria 21429
70 Ga0123356_10658127 3300010049 Bacteria 1215
71 AustNasuHG_c1059269 3300000089 Bacteria 751
72 FAAS_10657565 3300001880 Bacteria 536
73 JGI24698J34947_10038545 3300002449 Bacteria 2478
74 Ga0466732_024754 3300042656 Bacteria 1743
75 Ga0466703_094356 3300042636 Bacteria 13418
76 Ga0466709_076525 3300042648 Bacteria 12746
77 Ga0466708_103759 3300042652 Bacteria 5985
78 Ga0466708_170404 3300042652 Bacteria 4071
79 Ga0466692_187947 3300042591 Bacteria 1033
80 Ga0466693_192043 3300042592 Bacteria 8421
81 Ga0466694_232046 3300042594 Bacteria 1361
82 Ga0466696_465596 3300042596 Unclassified 2362
83 Ga0466699_331797 3300042597 Bacteria 3781
84 Ga0466701_001700 3300042598 Bacteria 1334
85 Ga0466720_039802 3300042607 Bacteria 11163
86 Ga0466718_004638 3300042617 Bacteria 24050
87 Ga0466718_033388 3300042617 Bacteria 14281
88 Ga0123356_13043975 3300010049 Bacteria 585
89 Ga0123353_10087712 3300010167 Bacteria 5011
90 Ga0466703_232900 3300042636 Bacteria 8550
91 Ga0466704_016291 3300042643 Bacteria 18399
92 Ga0264413_139815 3300024493 Bacteria 3462
93 Ga0466690_408423 3300042590 Bacteria 1733
94 Ga0466696_031445 3300042596 Archaea 3465
95 Ga0466699_075077 3300042597 Bacteria 1312
96 Ga0466699_126849 3300042597 Bacteria 15271
97 Ga0466699_234070 3300042597 Bacteria 16195
98 Ga0466720_055497 3300042607 Bacteria 6491
99 Ga0466715_062632 3300042616 Bacteria 11333
100 Ga0123355_10000434 3300009826 Bacteria 54971
101 JGI24695J34938_10000924 3300002450 Bacteria 26865
102 JGI24695J34938_10003053 3300002450 Bacteria 11995
103 JGI24695J34938_10042884 3300002450 Bacteria 2022
104 JGI24702J35022_10001877 3300002462 Bacteria 12931
105 Ga0264413_123898 3300024493 Bacteria 4434
106 Ga0415639_018117 3300038395 Bacteria 21951
107 Ga0466690_174407 3300042590 Bacteria 3112
108 Ga0466691_222105 3300042593 Bacteria 8706
109 Ga0466696_231225 3300042596 Bacteria 5744
110 Ga0466699_063680 3300042597 Bacteria 13141
111 Ga0466716_106786 3300042605 Bacteria 35327
112 Ga0466719_547503 3300042606 Bacteria 1248
113 Ga0466705_425651 3300042612 Bacteria 1259
114 Ga0466715_059303 3300042616 Bacteria 8334
115 Ga0466715_477796 3300042616 Bacteria 17116
116 Ga0466718_033746 3300042617 Bacteria 2859
117 Ga0466723_120220 3300042618 Bacteria 2797
118 Ga0466728_455662 3300042620 Bacteria 6895
119 Ga0123356_12523347 3300010049 Bacteria 643
120 Ga0123356_12549036 3300010049 Bacteria 640
121 Ga0123356_12747866 3300010049 Bacteria 616
122 Ga0123353_12585778 3300010167 Bacteria 601
123 JGI24698J34947_10021872 3300002449 Bacteria 3435
124 JGI24698J34947_10031253 3300002449 Bacteria 2804
125 JGI24695J34938_10003043 3300002450 Bacteria 12026
126 Ga0466705_038472 3300042612 Bacteria 21059
127 Ga0466705_234948 3300042612 Bacteria 8944
128 Ga0466735_100953 3300042624 Bacteria 12211
129 Ga0466692_003856 3300042591 Bacteria 11624
130 Ga0466691_133259 3300042593 Bacteria 7180
131 Ga0466691_133837 3300042593 Bacteria 9141
132 Ga0466694_297645 3300042594 Bacteria 1201
133 Ga0466699_437490 3300042597 Bacteria 2183
134 Ga0466719_144176 3300042606 Bacteria 32253
135 Ga0466720_178145 3300042607 Bacteria 1769
136 Ga0466711_422683 3300042615 Bacteria 2214
137 Ga0466715_303816 3300042616 Bacteria 14455
138 Ga0466718_092660 3300042617 Bacteria 3600
139 Ga0466726_062662 3300042619 Bacteria 3492
140 Ga0466728_102746 3300042620 Bacteria 2602
141 Ga0123356_10373702 3300010049 Bacteria 1556
142 Ga0123356_11964985 3300010049 Bacteria 729
143 JGI24695J34938_10007709 3300002450 Bacteria 6244
144 JGI24695J34938_10014319 3300002450 Bacteria 4115
145 JGI24702J35022_10060254 3300002462 Bacteria 2029
146 JGI24705J35276_11847352 3300002504 Bacteria 713

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_004462 Ga0466699_004462_11579_11839 86
2 3300042597 Ga0466699_080963 Ga0466699_080963_169_429 86
3 3300042597 Ga0466699_331797 Ga0466699_331797_3207_3467 86
4 3300042597 Ga0466699_334582 Ga0466699_334582_4909_5169 86
5 3300042597 Ga0466699_355360 Ga0466699_355360_1283_1543 86
6 3300002449 JGI24698J34947_10021872 JGI24698J34947_100218725 87
7 3300002449 JGI24698J34947_10030734 JGI24698J34947_100307344 87
8 3300002449 JGI24698J34947_10298966 JGI24698J34947_102989661 87
9 3300024493 Ga0264413_108977 Ga0264413_1089774 87
10 3300024493 Ga0264413_123898 Ga0264413_1238985 87
11 3300024493 Ga0264413_139815 Ga0264413_1398154 87
12 3300038395 Ga0415639_018117 Ga0415639_018117_15168_15431 87
13 3300042590 Ga0466690_174407 Ga0466690_174407_1282_1545 87
14 3300042590 Ga0466690_408423 Ga0466690_408423_1089_1352 87
15 3300042591 Ga0466692_003856 Ga0466692_003856_6543_6806 87
16 3300042591 Ga0466692_083091 Ga0466692_083091_1121_1384 87
17 3300042591 Ga0466692_116465 Ga0466692_116465_10829_11092 87
18 3300042591 Ga0466692_138087 Ga0466692_138087_468_731 87
19 3300042591 Ga0466692_154744 Ga0466692_154744_294_557 87
20 3300042591 Ga0466692_187947 Ga0466692_187947_684_947 87
21 3300042592 Ga0466693_096673 Ga0466693_096673_2474_2737 87
22 3300042592 Ga0466693_303364 Ga0466693_303364_3500_3763 87
23 3300042592 Ga0466693_405235 Ga0466693_405235_1871_2134 87
24 3300042593 Ga0466691_133259 Ga0466691_133259_6176_6439 87
25 3300042593 Ga0466691_133837 Ga0466691_133837_3207_3470 87
26 3300042593 Ga0466691_155341 Ga0466691_155341_5665_5928 87
27 3300042593 Ga0466691_222105 Ga0466691_222105_2196_2459 87
28 3300042594 Ga0466694_031771 Ga0466694_031771_743_1006 87
29 3300042594 Ga0466694_232046 Ga0466694_232046_139_402 87
30 3300042594 Ga0466694_289868 Ga0466694_289868_1028_1291 87
31 3300042594 Ga0466694_297645 Ga0466694_297645_889_1152 87
32 3300042596 Ga0466696_231225 Ga0466696_231225_3113_3376 87
33 3300042596 Ga0466696_233847 Ga0466696_233847_25_288 87
34 3300042596 Ga0466696_255031 Ga0466696_255031_630_893 87
35 3300042596 Ga0466696_279796 Ga0466696_279796_166_429 87
36 3300042596 Ga0466696_279885 Ga0466696_279885_1072_1335 87
37 3300042596 Ga0466696_465596 Ga0466696_465596_13_276 87
38 3300042597 Ga0466699_063680 Ga0466699_063680_4861_5124 87
39 3300042597 Ga0466699_075077 Ga0466699_075077_992_1255 87
40 3300042597 Ga0466699_126849 Ga0466699_126849_8473_8736 87
41 3300042597 Ga0466699_234070 Ga0466699_234070_3359_3622 87
42 3300042597 Ga0466699_262757 Ga0466699_262757_723_986 87
43 3300042597 Ga0466699_263841 Ga0466699_263841_2847_3110 87
44 3300042597 Ga0466699_293350 Ga0466699_293350_2550_2813 87
45 3300042597 Ga0466699_444056 Ga0466699_444056_6604_6867 87
46 3300042598 Ga0466701_001700 Ga0466701_001700_769_1032 87
47 3300042605 Ga0466716_106786 Ga0466716_106786_6964_7227 87
48 3300042606 Ga0466719_144176 Ga0466719_144176_15586_15849 87
49 3300042606 Ga0466719_149280 Ga0466719_149280_4025_4288 87
50 3300042606 Ga0466719_470329 Ga0466719_470329_4201_4464 87
51 3300042606 Ga0466719_547503 Ga0466719_547503_321_584 87
52 3300042607 Ga0466720_022123 Ga0466720_022123_187_450 87
53 3300042607 Ga0466720_055497 Ga0466720_055497_2003_2266 87
54 3300042607 Ga0466720_178145 Ga0466720_178145_10_273 87
55 3300042607 Ga0466720_217810 Ga0466720_217810_5430_5693 87
56 3300042612 Ga0466705_003616 Ga0466705_003616_13995_14258 87
57 3300042612 Ga0466705_038472 Ga0466705_038472_2116_2379 87
58 3300042612 Ga0466705_234948 Ga0466705_234948_935_1198 87
59 3300042612 Ga0466705_425651 Ga0466705_425651_481_744 87
60 3300042615 Ga0466711_422683 Ga0466711_422683_570_833 87
61 3300042616 Ga0466715_021799 Ga0466715_021799_6921_7184 87
62 3300042616 Ga0466715_059303 Ga0466715_059303_1893_2156 87
63 3300042616 Ga0466715_062632 Ga0466715_062632_1893_2156 87
64 3300042616 Ga0466715_148323 Ga0466715_148323_1880_2143 87
65 3300042616 Ga0466715_252975 Ga0466715_252975_5489_5752 87
66 3300042616 Ga0466715_303816 Ga0466715_303816_7000_7263 87
67 3300042616 Ga0466715_477796 Ga0466715_477796_6984_7247 87
68 3300042617 Ga0466718_004638 Ga0466718_004638_21026_21289 87
69 3300042617 Ga0466718_033388 Ga0466718_033388_1691_1954 87
70 3300042617 Ga0466718_033746 Ga0466718_033746_1062_1325 87
71 3300042617 Ga0466718_092660 Ga0466718_092660_1418_1681 87
72 3300042618 Ga0466723_105234 Ga0466723_105234_4300_4563 87
73 3300042618 Ga0466723_120220 Ga0466723_120220_1978_2241 87
74 3300042618 Ga0466723_252971 Ga0466723_252971_728_991 87
75 3300042619 Ga0466726_062662 Ga0466726_062662_1842_2105 87
76 3300042619 Ga0466726_063115 Ga0466726_063115_920_1183 87
77 3300042620 Ga0466728_102746 Ga0466728_102746_1739_2002 87
78 3300042620 Ga0466728_235690 Ga0466728_235690_8045_8308 87
79 3300042620 Ga0466728_455662 Ga0466728_455662_3284_3547 87
80 3300042624 Ga0466735_100953 Ga0466735_100953_7802_8065 87
81 3300042636 Ga0466703_048944 Ga0466703_048944_140_403 87
82 3300042636 Ga0466703_094356 Ga0466703_094356_12040_12303 87
83 3300042636 Ga0466703_099911 Ga0466703_099911_1199_1462 87
84 3300042636 Ga0466703_232900 Ga0466703_232900_5233_5496 87
85 3300042636 Ga0466703_244349 Ga0466703_244349_6732_6995 87
86 3300042643 Ga0466704_011268 Ga0466704_011268_9077_9340 87
87 3300042643 Ga0466704_016291 Ga0466704_016291_14284_14547 87
88 3300042643 Ga0466704_118862 Ga0466704_118862_2702_2965 87
89 3300042643 Ga0466704_237034 Ga0466704_237034_9928_10191 87
90 3300042643 Ga0466704_239661 Ga0466704_239661_7172_7435 87
91 3300042643 Ga0466704_473977 Ga0466704_473977_12082_12345 87
92 3300042648 Ga0466709_076525 Ga0466709_076525_5263_5526 87
93 3300042648 Ga0466709_418869 Ga0466709_418869_387_650 87
94 3300042652 Ga0466708_093813 Ga0466708_093813_50_313 87
95 3300042652 Ga0466708_103759 Ga0466708_103759_4658_4921 87
96 3300042652 Ga0466708_170404 Ga0466708_170404_1992_2255 87
97 3300042655 Ga0466727_098262 Ga0466727_098262_1485_1748 87
98 3300042656 Ga0466732_024754 Ga0466732_024754_985_1248 87
99 3300042656 Ga0466732_133919 Ga0466732_133919_60_323 87
100 3300042656 Ga0466732_206748 Ga0466732_206748_3911_4174 87
101 3300042656 Ga0466732_352220 Ga0466732_352220_512_775 87
102 iso_pr_bacteria 2781125633 2781272176 87
103 iso_pr_bacteria 2781125639 2781285318 87
104 iso_pr_bacteria 2781125640 2781287103 87
105 iso_pr_bacteria 2781125656 2781320019 87
106 iso_pr_bacteria 2781125658 2781325042 87
107 iso_pr_bacteria 2781125695 2781437748 87
108 3300000089 AustNasuHG_c1010155 AustNasuHG_10101554 88
109 3300000089 AustNasuHG_c1059269 AustNasuHG_10592692 88
110 3300001880 FAAS_10657565 FAAS_106575652 88
111 3300002449 JGI24698J34947_10031253 JGI24698J34947_100312532 88
112 3300002449 JGI24698J34947_10038545 JGI24698J34947_100385452 88
113 3300002450 JGI24695J34938_10000924 JGI24695J34938_1000092420 88
114 3300002450 JGI24695J34938_10003043 JGI24695J34938_100030434 88
115 3300002450 JGI24695J34938_10003053 JGI24695J34938_100030539 88
116 3300002450 JGI24695J34938_10007648 JGI24695J34938_100076483 88
117 3300002450 JGI24695J34938_10007709 JGI24695J34938_100077092 88
118 3300002450 JGI24695J34938_10014319 JGI24695J34938_100143194 88
119 3300002450 JGI24695J34938_10022191 JGI24695J34938_100221914 88
120 3300002450 JGI24695J34938_10042884 JGI24695J34938_100428841 88
121 3300002450 JGI24695J34938_10126587 JGI24695J34938_101265872 88
122 3300002462 JGI24702J35022_10001877 JGI24702J35022_100018779 88
123 3300002462 JGI24702J35022_10060254 JGI24702J35022_100602542 88
124 3300002504 JGI24705J35276_11847352 JGI24705J35276_118473522 88
125 3300005201 Ga0072941_1046872 Ga0072941_10468724 88
126 3300005485 Ga0074263_101332 Ga0074263_1013323 88
127 3300009826 Ga0123355_10008175 Ga0123355_1000817511 88
128 3300010049 Ga0123356_10001613 Ga0123356_1000161316 88
129 3300010049 Ga0123356_10002113 Ga0123356_100021135 88
130 3300010049 Ga0123356_10373702 Ga0123356_103737022 88
131 3300010049 Ga0123356_10658127 Ga0123356_106581271 88
132 3300010049 Ga0123356_11964985 Ga0123356_119649852 88
133 3300010049 Ga0123356_12523347 Ga0123356_125233471 88
134 3300010049 Ga0123356_12549036 Ga0123356_125490362 88
135 3300010049 Ga0123356_12747866 Ga0123356_127478662 88
136 3300010049 Ga0123356_13043975 Ga0123356_130439751 88
137 3300010167 Ga0123353_10087712 Ga0123353_100877124 88
138 3300010167 Ga0123353_10907966 Ga0123353_109079663 88
139 3300010167 Ga0123353_12585778 Ga0123353_125857781 88
140 3300042592 Ga0466693_192043 Ga0466693_192043_5692_5958 88
141 3300042596 Ga0466696_437602 Ga0466696_437602_4671_4937 88
142 3300042597 Ga0466699_437490 Ga0466699_437490_1857_2123 88
143 3300042619 Ga0466726_034345 Ga0466726_034345_15741_16007 88
144 iso_pr_bacteria 2781125632 2781272070 88
145 iso_pr_bacteria 2781125655 2781316920 88
146 3300002450 JGI24695J34938_10051124 JGI24695J34938_100511242 89
147 3300002450 JGI24695J34938_10052352 JGI24695J34938_100523522 89
148 3300009826 Ga0123355_10000434 Ga0123355_100004346 89
149 3300042615 Ga0466711_094892 Ga0466711_094892_18895_19164 89
150 3300009826 Ga0123355_10147440 Ga0123355_101474403 90
151 3300042597 Ga0466699_234122 Ga0466699_234122_695_967 90
152 3300042607 Ga0466720_039802 Ga0466720_039802_6500_6772 90
153 3300042602 Ga0466713_143214 Ga0466713_143214_1070_1360 96
154 3300042596 Ga0466696_031445 Ga0466696_031445_2992_3300 102

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.