Protein Family IF05042

Metagenome Isolate
153 Members
64 Samples
130 Scaffolds
247.56 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_319537|Ga0466694_319537_1100_1981
Length
293 aa
Sequence
MCERKNHIPCPISWAKRRCFILKGMHSNISEKSCFLYYRCLRIGVFLMIDLKGKTAIVTGATRGIGLEISKVLAENGANVAIIDIQLGDGSSIKEVEALGVTCKGYACDVSNPEAVEETFKQIVTEFGKVDILVNNAGITRDNLIIRMKQEDFDAVLNVNLRSAFICTKAISSHLMRNRSGRIINMASINGIRCQAGQANYAASKAGIIGLTKSNAMEFAARGVTVNAVAPGFIKTAMTDKLAPETIAKYKEAIPLKDLGSPRDVANVVAFLASNEAAYVTGQVLGVDGGLGA

📊 Sample Types

Isolate 15.0%
Metagenome 85.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.2%
Unclassified 27.4%
Kalotermitidae 16.1%
Rhinotermitidae 3.2%
Formicidae 3.2%
Termopsidae 3.2%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 33

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
2 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
3 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
7 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
8 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
9 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
12 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
13 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 2900368070 Nocardia aurantia RB56 Isolate Termitidae
16 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
17 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
18 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
19 2773857779 Unclassified Fibrobacteres Co191P1bin69 Isolate Unclassified
20 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
23 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
24 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
25 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
26 2778260939 Unclassified Fibrobacteres Co191P4bin13 Isolate Unclassified
27 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
28 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
29 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
30 2820714932 Unclassified Fibrobacteres Nc150P4bin10 Isolate Unclassified
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
33 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
36 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
37 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
40 2820556368 Unclassified Firmicutes Emb289P3bin92 Isolate Unclassified
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
47 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
48 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
49 2820716747 Unclassified Fibrobacteres Nc150P3bin18 Isolate Unclassified
50 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
51 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
52 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
53 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
54 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
55 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
56 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
57 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
58 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
59 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
60 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
61 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
62 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
63 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
64 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_161467 3300038395 Bacteria 1877
2 Ga0466696_067962 3300042596 Bacteria 14049
3 Ga0466718_149888 3300042617 Unclassified 4562
4 Ga0466706_217297 3300042599 Bacteria 3011
5 Ga0123356_10015172 3300010049 Bacteria 7386
6 Ga0123356_10399332 3300010049 Bacteria 1512
7 Ga0123353_10152468 3300010167 Unclassified 3688
8 Ga0123353_10440941 3300010167 Bacteria 1921
9 Ga0123353_10477881 3300010167 Bacteria 1824
10 Ga0466709_118290 3300042648 Bacteria 5953
11 AustNasuHG_c1003368 3300000089 Bacteria 5774
12 JGI24698J34947_10012942 3300002449 Unclassified 4559
13 JGI24695J34938_10013020 3300002450 Unclassified 4384
14 Ga0466694_064587 3300042594 Unclassified 2771
15 Ga0466694_319537 3300042594 Bacteria 7751
16 Ga0466699_033447 3300042597 Bacteria 6312
17 Ga0466712_065804 3300042614 Bacteria 33390
18 Ga0466715_077272 3300042616 Bacteria 6751
19 Ga0466718_131678 3300042617 Unclassified 1281
20 Ga0466718_146389 3300042617 Bacteria 14038
21 Ga0466720_051774 3300042607 Bacteria 19884
22 Ga0123355_10085790 3300009826 Unclassified 5009
23 Ga0123356_10005376 3300010049 Bacteria 13047
24 Ga0123356_10038186 3300010049 Bacteria 4475
25 Ga0123356_10078118 3300010049 Unclassified 3123
26 Ga0123356_10216188 3300010049 Bacteria 1970
27 Ga0123356_10324372 3300010049 Bacteria 1654
28 Ga0466702_137249 3300042635 Bacteria 2105
29 Ga0466702_353009 3300042635 Unclassified 1134
30 Ga0466703_408581 3300042636 Bacteria 1615
31 AustNasuHG_c1000867 3300000089 Unclassified 10884
32 Ga0072941_1003328 3300005201 Bacteria 50972
33 Ga0466690_408944 3300042590 Bacteria 5419
34 Ga0466705_432729 3300042612 Bacteria 55378
35 Ga0466715_117799 3300042616 Bacteria 1999
36 Ga0466726_035617 3300042619 Bacteria 12257
37 Ga0466719_297526 3300042606 Bacteria 28445
38 Ga0466720_109553 3300042607 Unclassified 27672
39 Ga0466698_375529 3300042610 Unclassified 1715
40 Ga0123355_10675236 3300009826 Bacteria 1196
41 Ga0123356_10047847 3300010049 Bacteria 3979
42 Ga0123356_10048497 3300010049 Bacteria 3952
43 Ga0123356_10127930 3300010049 Bacteria 2483
44 Ga0123354_10198356 3300010882 Bacteria 2217
45 Ga0466705_140978 3300042612 Bacteria 8865
46 Ga0466731_374566 3300042622 Bacteria 5651
47 Ga0466702_286040 3300042635 Unclassified 1240
48 Ga0466702_448627 3300042635 Bacteria 11495
49 AustNasuHG_c1045610 3300000089 Unclassified 1000
50 Ga0072941_1004457 3300005201 Bacteria 19474
51 Ga0415639_239354 3300038395 Bacteria 1132
52 Ga0466694_020212 3300042594 Unclassified 8350
53 Ga0466694_048822 3300042594 Bacteria 9383
54 Ga0466712_182106 3300042614 Bacteria 1767
55 Ga0123356_10000006 3300010049 Bacteria 247371
56 Ga0466704_007949 3300042643 Bacteria 5065
57 JGI24696J40584_12961719 3300002834 Bacteria 72636
58 Ga0072940_1009133 3300005200 Bacteria 7616
59 Ga0072940_1029227 3300005200 Unclassified 2970
60 Ga0072941_1000047 3300005201 Bacteria 107170
61 Ga0102738_1002447 3300007141 Bacteria 2771
62 Ga0264413_102892 3300024493 Unclassified 13118
63 Ga0264413_103541 3300024493 Bacteria 11905
64 Ga0466691_066382 3300042593 Bacteria 7235
65 Ga0466718_018071 3300042617 Unclassified 9811
66 Ga0466718_090025 3300042617 Unclassified 15108
67 Ga0466706_052531 3300042599 Bacteria 4764
68 Ga0466717_042983 3300042604 Bacteria 2095
69 Ga0466720_050028 3300042607 Bacteria 93115
70 Ga0123356_10356163 3300010049 Bacteria 1589
71 Ga0123356_10382239 3300010049 Bacteria 1541
72 Ga0123353_10300283 3300010167 Bacteria 2452
73 Ga0466730_063479 3300042625 Bacteria 44022
74 Ga0466703_137417 3300042636 Bacteria 6558
75 Ga0466704_424510 3300042643 Unclassified 1741
76 2230929979 2228664001 Unclassified 6395
77 JGI24695J34938_10003190 3300002450 Bacteria 11628
78 CVPL010W_10002843 3300002931 Bacteria 20148
79 Ga0072940_1004334 3300005200 Unclassified 9895
80 Ga0072941_1014362 3300005201 Bacteria 28449
81 Ga0072941_1037351 3300005201 Unclassified 16442
82 Ga0072941_1054504 3300005201 Bacteria 7250
83 Ga0466732_170426 3300042656 Bacteria 3066
84 Ga0466694_025955 3300042594 Unclassified 1800
85 Ga0466694_207296 3300042594 Bacteria 10315
86 Ga0466705_485285 3300042612 Bacteria 9969
87 Ga0466712_165115 3300042614 Bacteria 10115
88 Ga0466712_189080 3300042614 Unclassified 13796
89 Ga0466718_095232 3300042617 Unclassified 15320
90 Ga0466706_062060 3300042599 Bacteria 24698
91 Ga0466705_175659 3300042612 Bacteria 2329
92 Ga0466702_012684 3300042635 Unclassified 14532
93 AustNasuHG_c1010464 3300000089 Unclassified 3232
94 AustNasuHG_c1016636 3300000089 Unclassified 2455
95 JGI24698J34947_10000181 3300002449 Bacteria 24967
96 JGI24695J34938_10000001 3300002450 Bacteria 290906
97 Ga0466696_344329 3300042596 Bacteria 5546
98 Ga0466712_037983 3300042614 Bacteria 12191
99 Ga0466712_296032 3300042614 Bacteria 21817
100 Ga0466718_030169 3300042617 Unclassified 7290
101 Ga0466720_007470 3300042607 Bacteria 49010
102 Ga0466721_094341 3300042608 Bacteria 36475
103 Ga0466722_067351 3300042609 Bacteria 51487
104 Ga0123355_10025709 3300009826 Bacteria 9481
105 Ga0123356_10005584 3300010049 Bacteria 12791
106 Ga0123356_10022857 3300010049 Bacteria 5897
107 Ga0123353_10034826 3300010167 Bacteria 7868
108 Ga0123353_10111014 3300010167 Bacteria 4417
109 Ga0123353_10138061 3300010167 Bacteria 3909
110 Ga0466729_282411 3300042621 Bacteria 6891
111 Ga0466702_204397 3300042635 Unclassified 3945
112 Ga0072941_1035084 3300005201 Bacteria 9775
113 Ga0466732_171515 3300042656 Archaea 1384
114 Ga0466696_472700 3300042596 Bacteria 2183
115 Ga0466705_397052 3300042612 Bacteria 4429
116 Ga0466728_121798 3300042620 Bacteria 2829
117 Ga0466714_016426 3300042603 Bacteria 18818
118 Ga0466719_082011 3300042606 Bacteria 2207
119 Ga0123355_10187905 3300009826 Bacteria 3050
120 Ga0123356_10113773 3300010049 Bacteria 2619
121 Ga0123356_10443494 3300010049 Bacteria 1445
122 Ga0123356_11085716 3300010049 Bacteria 969
123 Ga0123353_10132479 3300010167 Bacteria 3999
124 Ga0466703_022345 3300042636 Bacteria 41652
125 Ga0466709_302719 3300042648 Bacteria 2180
126 Ga0466725_038924 3300042654 Bacteria 9866
127 JGI24695J34938_10010085 3300002450 Bacteria 5206
128 Ga0068302_10002987 3300005071 Bacteria 33512
129 Ga0072940_1026895 3300005200 Unclassified 8315
130 Ga0072941_1072193 3300005201 Unclassified 10162

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_397052 Ga0466705_397052_55_720 221
2 3300042636 Ga0466703_022345 Ga0466703_022345_35179_35922 228
3 3300009826 Ga0123355_10085790 Ga0123355_100857903 237
4 3300010049 Ga0123356_11085716 Ga0123356_110857161 237
5 3300010167 Ga0123353_10440941 Ga0123353_104409413 237
6 3300042609 Ga0466722_067351 Ga0466722_067351_35879_36595 238
7 3300002931 CVPL010W_10002843 CVPL010W_100028433 239
8 3300010049 Ga0123356_10005584 Ga0123356_100055844 239
9 iso_pr_bacteria 2820570671 2820571065 239
10 3300009826 Ga0123355_10675236 Ga0123355_106752362 240
11 3300042596 Ga0466696_344329 Ga0466696_344329_4654_5376 240
12 3300042620 Ga0466728_121798 Ga0466728_121798_1673_2395 240
13 iso_pr_bacteria 2820666966 2820667141 240
14 3300002450 JGI24695J34938_10000001 JGI24695J34938_10000001176 241
15 3300042599 Ga0466706_217297 Ga0466706_217297_278_1003 241
16 3300042635 Ga0466702_448627 Ga0466702_448627_4456_5181 241
17 3300010049 Ga0123356_10324372 Ga0123356_103243722 242
18 3300010167 Ga0123353_10300283 Ga0123353_103002832 242
19 iso_pr_bacteria 2820535361 2820536075 242
20 iso_pr_bacteria 2820539610 2820539627 242
21 3300010049 Ga0123356_10022857 Ga0123356_100228574 243
22 3300042654 Ga0466725_038924 Ga0466725_038924_8030_8761 243
23 3300042596 Ga0466696_472700 Ga0466696_472700_592_1326 244
24 3300042606 Ga0466719_297526 Ga0466719_297526_18054_18788 244
25 3300042612 Ga0466705_175659 Ga0466705_175659_829_1563 244
26 3300042636 Ga0466703_408581 Ga0466703_408581_700_1434 244
27 3300042648 Ga0466709_302719 Ga0466709_302719_651_1385 244
28 3300010167 Ga0123353_10111014 Ga0123353_101110142 245
29 3300010167 Ga0123353_10152468 Ga0123353_101524682 245
30 3300042612 Ga0466705_432729 Ga0466705_432729_7499_8236 245
31 2228664001 2230929979 2230625542 246
32 3300024493 Ga0264413_102892 Ga0264413_1028924 246
33 3300042590 Ga0466690_408944 Ga0466690_408944_388_1128 246
34 3300042593 Ga0466691_066382 Ga0466691_066382_4973_5713 246
35 3300042594 Ga0466694_020212 Ga0466694_020212_4258_4998 246
36 3300042594 Ga0466694_025955 Ga0466694_025955_170_910 246
37 3300042594 Ga0466694_048822 Ga0466694_048822_3908_4648 246
38 3300042594 Ga0466694_064587 Ga0466694_064587_1755_2495 246
39 3300042597 Ga0466699_033447 Ga0466699_033447_2556_3296 246
40 3300042603 Ga0466714_016426 Ga0466714_016426_3233_3973 246
41 3300042604 Ga0466717_042983 Ga0466717_042983_573_1313 246
42 3300042606 Ga0466719_082011 Ga0466719_082011_1031_1771 246
43 3300042607 Ga0466720_007470 Ga0466720_007470_10104_10844 246
44 3300042607 Ga0466720_050028 Ga0466720_050028_7931_8671 246
45 3300042607 Ga0466720_109553 Ga0466720_109553_16860_17600 246
46 3300042608 Ga0466721_094341 Ga0466721_094341_23318_24058 246
47 3300042610 Ga0466698_375529 Ga0466698_375529_102_842 246
48 3300042612 Ga0466705_485285 Ga0466705_485285_7093_7833 246
49 3300042614 Ga0466712_037983 Ga0466712_037983_4885_5625 246
50 3300042614 Ga0466712_065804 Ga0466712_065804_3862_4602 246
51 3300042614 Ga0466712_165115 Ga0466712_165115_8537_9277 246
52 3300042614 Ga0466712_182106 Ga0466712_182106_191_931 246
53 3300042614 Ga0466712_189080 Ga0466712_189080_5858_6598 246
54 3300042616 Ga0466715_077272 Ga0466715_077272_3447_4187 246
55 3300042617 Ga0466718_018071 Ga0466718_018071_246_986 246
56 3300042617 Ga0466718_030169 Ga0466718_030169_6303_7043 246
57 3300042617 Ga0466718_090025 Ga0466718_090025_4427_5167 246
58 3300042617 Ga0466718_095232 Ga0466718_095232_4418_5158 246
59 3300042617 Ga0466718_131678 Ga0466718_131678_310_1050 246
60 3300042617 Ga0466718_146389 Ga0466718_146389_4471_5211 246
61 3300042617 Ga0466718_149888 Ga0466718_149888_686_1426 246
62 3300042622 Ga0466731_374566 Ga0466731_374566_1867_2607 246
63 3300042635 Ga0466702_012684 Ga0466702_012684_13676_14416 246
64 3300042635 Ga0466702_137249 Ga0466702_137249_523_1263 246
65 3300042635 Ga0466702_204397 Ga0466702_204397_1748_2488 246
66 3300042635 Ga0466702_286040 Ga0466702_286040_239_979 246
67 3300042635 Ga0466702_353009 Ga0466702_353009_149_889 246
68 3300042636 Ga0466703_137417 Ga0466703_137417_686_1426 246
69 3300042643 Ga0466704_424510 Ga0466704_424510_676_1416 246
70 3300042648 Ga0466709_118290 Ga0466709_118290_1212_1952 246
71 3300042656 Ga0466732_170426 Ga0466732_170426_1717_2457 246
72 iso_pr_bacteria 2740892545 2743908530 246
73 iso_pr_bacteria 2740892546 2743911553 246
74 iso_pr_bacteria 2773857779 2774478824 246
75 iso_pr_bacteria 2778260939 2778355067 246
76 iso_pr_bacteria 2778260941 2778359197 246
77 iso_pr_bacteria 2820714932 2820716033 246
78 iso_pr_bacteria 2820716747 2820718272 246
79 iso_pr_bacteria 8064531044 8064534108 246
80 3300000089 AustNasuHG_c1000867 AustNasuHG_10008679 247
81 3300000089 AustNasuHG_c1010464 AustNasuHG_10104644 247
82 3300000089 AustNasuHG_c1016636 AustNasuHG_10166363 247
83 3300000089 AustNasuHG_c1045610 AustNasuHG_10456101 247
84 3300002449 JGI24698J34947_10000181 JGI24698J34947_100001819 247
85 3300002449 JGI24698J34947_10012942 JGI24698J34947_100129422 247
86 3300002450 JGI24695J34938_10013020 JGI24695J34938_100130204 247
87 3300002834 JGI24696J40584_12961719 JGI24696J40584_1296171943 247
88 3300005200 Ga0072940_1004334 Ga0072940_100433412 247
89 3300005200 Ga0072940_1009133 Ga0072940_10091339 247
90 3300005200 Ga0072940_1029227 Ga0072940_10292272 247
91 3300005201 Ga0072941_1000047 Ga0072941_100004710 247
92 3300005201 Ga0072941_1003328 Ga0072941_100332819 247
93 3300005201 Ga0072941_1004457 Ga0072941_10044573 247
94 3300005201 Ga0072941_1014362 Ga0072941_10143627 247
95 3300005201 Ga0072941_1035084 Ga0072941_10350844 247
96 3300005201 Ga0072941_1037351 Ga0072941_103735114 247
97 3300005201 Ga0072941_1072193 Ga0072941_10721934 247
98 3300010049 Ga0123356_10015172 Ga0123356_100151726 247
99 3300010049 Ga0123356_10038186 Ga0123356_100381863 247
100 3300010049 Ga0123356_10048497 Ga0123356_100484974 247
101 3300010049 Ga0123356_10078118 Ga0123356_100781181 247
102 3300010049 Ga0123356_10113773 Ga0123356_101137732 247
103 3300010049 Ga0123356_10216188 Ga0123356_102161883 247
104 3300010049 Ga0123356_10356163 Ga0123356_103561632 247
105 3300010049 Ga0123356_10382239 Ga0123356_103822392 247
106 3300010049 Ga0123356_10399332 Ga0123356_103993321 247
107 3300010167 Ga0123353_10034826 Ga0123353_100348262 247
108 3300010167 Ga0123353_10477881 Ga0123353_104778811 247
109 3300024493 Ga0264413_103541 Ga0264413_10354110 247
110 3300042616 Ga0466715_117799 Ga0466715_117799_738_1481 247
111 3300042619 Ga0466726_035617 Ga0466726_035617_8599_9342 247
112 iso_pr_bacteria 2772190761 2772888429 247
113 3300000089 AustNasuHG_c1003368 AustNasuHG_10033683 248
114 3300005071 Ga0068302_10002987 Ga0068302_1000298723 248
115 3300005200 Ga0072940_1026895 Ga0072940_10268957 248
116 3300010049 Ga0123356_10000006 Ga0123356_10000006149 248
117 3300010882 Ga0123354_10198356 Ga0123354_101983562 248
118 3300042643 Ga0466704_007949 Ga0466704_007949_2595_3341 248
119 iso_pr_bacteria 8046957834 8046967011 248
120 3300005201 Ga0072941_1054504 Ga0072941_10545047 249
121 3300009826 Ga0123355_10025709 Ga0123355_100257098 249
122 3300010049 Ga0123356_10443494 Ga0123356_104434942 249
123 3300042614 Ga0466712_296032 Ga0466712_296032_8631_9380 249
124 iso_pr_bacteria 2778260937 2778348533 249
125 3300002450 JGI24695J34938_10003190 JGI24695J34938_100031909 250
126 3300002450 JGI24695J34938_10010085 JGI24695J34938_100100852 250
127 3300038395 Ga0415639_161467 Ga0415639_161467_328_1080 250
128 3300042607 Ga0466720_051774 Ga0466720_051774_16427_17179 250
129 iso_pr_bacteria 2820556368 2820557633 251
130 3300010049 Ga0123356_10005376 Ga0123356_100053767 252
131 3300042612 Ga0466705_140978 Ga0466705_140978_1078_1836 252
132 3300042621 Ga0466729_282411 Ga0466729_282411_5444_6202 252
133 3300007141 Ga0102738_1002447 Ga0102738_10024471 253
134 3300010049 Ga0123356_10047847 Ga0123356_100478474 253
135 3300038395 Ga0415639_239354 Ga0415639_239354_265_1026 253
136 3300042596 Ga0466696_067962 Ga0466696_067962_6897_7658 253
137 3300042599 Ga0466706_062060 Ga0466706_062060_21182_21943 253
138 3300042625 Ga0466730_063479 Ga0466730_063479_30629_31390 253
139 iso_pr_bacteria 2900354037 2900358326 253
140 3300010049 Ga0123356_10127930 Ga0123356_101279302 256
141 3300009826 Ga0123355_10187905 Ga0123355_101879052 257
142 iso_pr_bacteria 2900354037 2900359141 257
143 iso_pr_bacteria 2900354037 2900359143 257
144 iso_pr_bacteria 2585428085 2587835913 258
145 iso_pr_bacteria 2820457604 2820459231 259
146 3300010167 Ga0123353_10132479 Ga0123353_101324792 260
147 3300042594 Ga0466694_207296 Ga0466694_207296_386_1171 261
148 3300010167 Ga0123353_10138061 Ga0123353_101380613 263
149 iso_pr_bacteria 2900354037 2900355193 265
150 iso_pr_bacteria 2900368070 2900369115 265
151 3300042656 Ga0466732_171515 Ga0466732_171515_158_973 271
152 3300042599 Ga0466706_052531 Ga0466706_052531_2234_3085 283
153 3300042594 Ga0466694_319537 Ga0466694_319537_1100_1981 293

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 54 243 0.98
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 60 291 0.97
PF08659 KR KR domain 55 207 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.