Protein Family IF05036
Metagenome
Isolate
133
Members
50
Samples
131
Scaffolds
113.56
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_294117|Ga0466694_294117_469_843
- Length
- 124 aa
- Sequence
- MFKTKMPMLKVIILTIFQCFLLAGGQVCFKLAVEKINKFQWSWAYFADLLTNWWLLASGICLIAATVLWGYVLKHFTFSVAYPVTAFAYIFGMLAAVFIFHETVPLTRWIGVGFIILGVILIAK
Sample Types
Isolate
1.5%
Metagenome
98.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.1%
Kalotermitidae
22.4%
Unclassified
8.2%
Rhinotermitidae
6.1%
Termopsidae
6.1%
Passalidae
4.1%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 18 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 21 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 27 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10651773 | 3300010049 | Bacteria | 1220 |
| 2 | Ga0123356_13324812 | 3300010049 | Bacteria | 559 |
| 3 | Ga0466657_289838 | 3300042582 | Bacteria | 1024 |
| 4 | Ga0466690_016733 | 3300042590 | Bacteria | 4871 |
| 5 | Ga0466690_211524 | 3300042590 | Bacteria | 4569 |
| 6 | 2227120014 | 2225789004 | Unclassified | 1704 |
| 7 | JGI24702J35022_10036471 | 3300002462 | Bacteria | 2627 |
| 8 | JGI24696J40584_12918452 | 3300002834 | Bacteria | 1322 |
| 9 | Ga0072941_1617462 | 3300005201 | Bacteria | 1955 |
| 10 | Ga0466703_216171 | 3300042636 | Bacteria | 1077 |
| 11 | Ga0466703_379471 | 3300042636 | Bacteria | 9846 |
| 12 | Ga0466704_053606 | 3300042643 | Bacteria | 19307 |
| 13 | Ga0466709_159378 | 3300042648 | Unclassified | 18288 |
| 14 | Ga0466726_364534 | 3300042619 | Bacteria | 1712 |
| 15 | Ga0466729_170993 | 3300042621 | Bacteria | 2045 |
| 16 | Ga0123356_11060309 | 3300010049 | Bacteria | 980 |
| 17 | Ga0123354_10271782 | 3300010882 | Bacteria | 1666 |
| 18 | Ga0466657_180981 | 3300042582 | Bacteria | 2513 |
| 19 | Ga0466692_124868 | 3300042591 | Bacteria | 6801 |
| 20 | Ga0466701_098115 | 3300042598 | Bacteria | 2784 |
| 21 | Ga0466720_091069 | 3300042607 | Bacteria | 2121 |
| 22 | Ga0466722_003345 | 3300042609 | Bacteria | 7335 |
| 23 | Ga0466735_046572 | 3300042624 | Unclassified | 9489 |
| 24 | Ga0466704_306961 | 3300042643 | Bacteria | 9166 |
| 25 | Ga0466709_415522 | 3300042648 | Bacteria | 256883 |
| 26 | Ga0466727_310729 | 3300042655 | Bacteria | 3200 |
| 27 | Ga0466710_251195 | 3300042613 | Bacteria | 3235 |
| 28 | Ga0466715_251026 | 3300042616 | Bacteria | 3806 |
| 29 | Ga0466733_193884 | 3300042659 | Bacteria | 2092 |
| 30 | Ga0123356_10049878 | 3300010049 | Bacteria | 3896 |
| 31 | Ga0123356_11192476 | 3300010049 | Bacteria | 928 |
| 32 | Ga0123353_11206956 | 3300010167 | Bacteria | 992 |
| 33 | Ga0123354_10021072 | 3300010882 | Bacteria | 10268 |
| 34 | Ga0123354_10284774 | 3300010882 | Unclassified | 1597 |
| 35 | Ga0466693_078591 | 3300042592 | Unclassified | 1459 |
| 36 | Ga0466693_086622 | 3300042592 | Bacteria | 1252 |
| 37 | Ga0466693_360315 | 3300042592 | Bacteria | 1506 |
| 38 | Ga0466691_043046 | 3300042593 | Unclassified | 4988 |
| 39 | Ga0466699_048170 | 3300042597 | Bacteria | 3137 |
| 40 | Ga0466699_080991 | 3300042597 | Bacteria | 2646 |
| 41 | Ga0466699_376983 | 3300042597 | Bacteria | 1482 |
| 42 | Ga0466716_202600 | 3300042605 | Bacteria | 25648 |
| 43 | Ga0466722_165928 | 3300042609 | Bacteria | 2313 |
| 44 | 2227589619 | 2225789004 | Bacteria | 2435 |
| 45 | JGI24702J35022_10138816 | 3300002462 | Unclassified | 1355 |
| 46 | Ga0123357_10002196 | 3300009784 | Bacteria | 21547 |
| 47 | Ga0466705_130431 | 3300042612 | Bacteria | 14655 |
| 48 | Ga0466725_103569 | 3300042654 | Bacteria | 1493 |
| 49 | Ga0466728_046855 | 3300042620 | Bacteria | 21751 |
| 50 | Ga0123356_12552964 | 3300010049 | Bacteria | 640 |
| 51 | Ga0123353_10171763 | 3300010167 | Bacteria | 3440 |
| 52 | Ga0466690_252535 | 3300042590 | Bacteria | 9427 |
| 53 | Ga0466692_013440 | 3300042591 | Bacteria | 17179 |
| 54 | Ga0466699_252379 | 3300042597 | Bacteria | 1535 |
| 55 | Ga0466698_489981 | 3300042610 | Bacteria | 1097 |
| 56 | IMNBL1DRAFT_c0021942 | 3300000062 | Unclassified | 2539 |
| 57 | JGI24702J35022_10005913 | 3300002462 | Bacteria | 7108 |
| 58 | JGI24696J40584_12911467 | 3300002834 | Bacteria | 1259 |
| 59 | Ga0466731_200235 | 3300042622 | Bacteria | 1061 |
| 60 | Ga0466731_358898 | 3300042622 | Bacteria | 87251 |
| 61 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 62 | Ga0466704_353545 | 3300042643 | Bacteria | 10170 |
| 63 | Ga0466710_075027 | 3300042613 | Bacteria | 1345 |
| 64 | Ga0466710_087023 | 3300042613 | Bacteria | 1929 |
| 65 | Ga0466733_107037 | 3300042659 | Bacteria | 20789 |
| 66 | Ga0123357_10055718 | 3300009784 | Bacteria | 5320 |
| 67 | Ga0123353_12187576 | 3300010167 | Unclassified | 670 |
| 68 | Ga0123354_10000685 | 3300010882 | Bacteria | 36047 |
| 69 | Ga0123354_10307308 | 3300010882 | Bacteria | 1488 |
| 70 | Ga0466701_031246 | 3300042598 | Bacteria | 5952 |
| 71 | Ga0466701_076278 | 3300042598 | Bacteria | 2785 |
| 72 | Ga0466707_150969 | 3300042601 | Bacteria | 29136 |
| 73 | Ga0466707_251501 | 3300042601 | Bacteria | 1184 |
| 74 | Ga0466717_287231 | 3300042604 | Bacteria | 2666 |
| 75 | Ga0466720_205983 | 3300042607 | Bacteria | 1936 |
| 76 | Ga0466721_236764 | 3300042608 | Bacteria | 1379 |
| 77 | IMNBL1DRAFT_c0045666 | 3300000062 | Bacteria | 1428 |
| 78 | JGI24702J35022_10552504 | 3300002462 | Bacteria | 710 |
| 79 | Ga0466731_210965 | 3300042622 | Bacteria | 1195 |
| 80 | Ga0466708_160687 | 3300042652 | Bacteria | 9714 |
| 81 | Ga0123357_10062445 | 3300009784 | Bacteria | 4988 |
| 82 | Ga0123356_11990634 | 3300010049 | Bacteria | 724 |
| 83 | Ga0123353_10486968 | 3300010167 | Bacteria | 1802 |
| 84 | Ga0466701_001524 | 3300042598 | Bacteria | 26824 |
| 85 | Ga0466707_346591 | 3300042601 | Bacteria | 1387 |
| 86 | JGI24702J35022_10016304 | 3300002462 | Bacteria | 4073 |
| 87 | JGI24702J35022_10386418 | 3300002462 | Bacteria | 843 |
| 88 | JGI24699J35502_10435224 | 3300002509 | Bacteria | 581 |
| 89 | Ga0068305_10046058 | 3300005083 | Bacteria | 15601 |
| 90 | Ga0466697_192850 | 3300042611 | Bacteria | 17708 |
| 91 | Ga0466734_134187 | 3300042623 | Bacteria | 1513 |
| 92 | Ga0466705_484269 | 3300042612 | Bacteria | 10914 |
| 93 | Ga0123353_10002651 | 3300010167 | Bacteria | 22277 |
| 94 | Ga0123353_10004595 | 3300010167 | Bacteria | 17820 |
| 95 | Ga0123353_10039653 | 3300010167 | Bacteria | 7418 |
| 96 | Ga0123354_10029114 | 3300010882 | Bacteria | 8693 |
| 97 | Ga0123354_10358687 | 3300010882 | Bacteria | 1288 |
| 98 | Ga0123354_10479671 | 3300010882 | Bacteria | 984 |
| 99 | Ga0466690_024376 | 3300042590 | Bacteria | 3641 |
| 100 | Ga0466690_227385 | 3300042590 | Bacteria | 20859 |
| 101 | Ga0466693_079387 | 3300042592 | Bacteria | 1217 |
| 102 | Ga0466693_272798 | 3300042592 | Bacteria | 1021 |
| 103 | Ga0466694_294117 | 3300042594 | Bacteria | 1080 |
| 104 | Ga0466701_103328 | 3300042598 | Bacteria | 1455 |
| 105 | Ga0466698_007777 | 3300042610 | Bacteria | 1087 |
| 106 | JGI24702J35022_10001801 | 3300002462 | Bacteria | 13211 |
| 107 | JGI24696J40584_12769307 | 3300002834 | Bacteria | 819 |
| 108 | JGI24696J40584_12950850 | 3300002834 | Bacteria | 2186 |
| 109 | JGI24696J40584_12956177 | 3300002834 | Bacteria | 3033 |
| 110 | Ga0068305_10284588 | 3300005083 | Bacteria | 1494 |
| 111 | Ga0072940_1145539 | 3300005200 | Bacteria | 1623 |
| 112 | Ga0466704_140482 | 3300042643 | Bacteria | 5561 |
| 113 | Ga0466715_153338 | 3300042616 | Bacteria | 101125 |
| 114 | Ga0466715_246897 | 3300042616 | Bacteria | 37494 |
| 115 | Ga0466723_368916 | 3300042618 | Bacteria | 12758 |
| 116 | Ga0466728_005858 | 3300042620 | Bacteria | 14772 |
| 117 | Ga0123357_10345375 | 3300009784 | Bacteria | 1432 |
| 118 | Ga0123354_10016193 | 3300010882 | Bacteria | 11678 |
| 119 | Ga0466691_007363 | 3300042593 | Bacteria | 13556 |
| 120 | Ga0466695_012662 | 3300042595 | Bacteria | 1280 |
| 121 | Ga0466700_251214 | 3300042600 | Bacteria | 1217 |
| 122 | Ga0466707_266959 | 3300042601 | Bacteria | 7101 |
| 123 | IMNBL1DRAFT_c0019357 | 3300000062 | Bacteria | 2793 |
| 124 | JGI24702J35022_10136998 | 3300002462 | Bacteria | 1363 |
| 125 | JGI24702J35022_10183532 | 3300002462 | Bacteria | 1190 |
| 126 | JGI24702J35022_10811477 | 3300002462 | Bacteria | 583 |
| 127 | JGI24705J35276_11735273 | 3300002504 | Bacteria | 650 |
| 128 | JGI24696J40584_12679684 | 3300002834 | Bacteria | 718 |
| 129 | Ga0072941_1162076 | 3300005201 | Unclassified | 4493 |
| 130 | Ga0466705_152274 | 3300042612 | Bacteria | 10050 |
| 131 | Ga0466710_370303 | 3300042613 | Bacteria | 2628 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005083 | Ga0068305_10046058 | Ga0068305_1004605810 | 97 |
| 2 | 3300000062 | IMNBL1DRAFT_c0019357 | IMNBL1DRAFT_00193573 | 99 |
| 3 | 3300002509 | JGI24699J35502_10435224 | JGI24699J35502_104352241 | 100 |
| 4 | 3300005201 | Ga0072941_1617462 | Ga0072941_16174623 | 100 |
| 5 | 3300042593 | Ga0466691_043046 | Ga0466691_043046_1092_1445 | 100 |
| 6 | 3300042597 | Ga0466699_376983 | Ga0466699_376983_142_495 | 100 |
| 7 | 3300042598 | Ga0466701_031246 | Ga0466701_031246_4850_5203 | 100 |
| 8 | 3300042598 | Ga0466701_098115 | Ga0466701_098115_2130_2483 | 100 |
| 9 | 3300042611 | Ga0466697_192850 | Ga0466697_192850_11058_11411 | 100 |
| 10 | 3300042643 | Ga0466704_140482 | Ga0466704_140482_3373_3726 | 100 |
| 11 | 3300042652 | Ga0466708_160687 | Ga0466708_160687_6272_6625 | 100 |
| 12 | 3300042622 | Ga0466731_210965 | Ga0466731_210965_602_958 | 101 |
| 13 | 3300002462 | JGI24702J35022_10036471 | JGI24702J35022_100364712 | 102 |
| 14 | 3300042612 | Ga0466705_152274 | Ga0466705_152274_6968_7321 | 102 |
| 15 | 3300042613 | Ga0466710_087023 | Ga0466710_087023_520_828 | 102 |
| 16 | 3300009784 | Ga0123357_10062445 | Ga0123357_100624457 | 103 |
| 17 | 3300010167 | Ga0123353_10171763 | Ga0123353_101717633 | 103 |
| 18 | 3300042592 | Ga0466693_078591 | Ga0466693_078591_466_777 | 103 |
| 19 | 3300010167 | Ga0123353_10004595 | Ga0123353_100045956 | 104 |
| 20 | 3300010167 | Ga0123353_12187576 | Ga0123353_121875762 | 104 |
| 21 | 3300010882 | Ga0123354_10000685 | Ga0123354_1000068513 | 104 |
| 22 | 3300042592 | Ga0466693_272798 | Ga0466693_272798_658_972 | 104 |
| 23 | 3300042597 | Ga0466699_080991 | Ga0466699_080991_1361_1675 | 104 |
| 24 | 3300042612 | Ga0466705_484269 | Ga0466705_484269_1710_2024 | 104 |
| 25 | 3300042643 | Ga0466704_002372 | Ga0466704_002372_12016_12330 | 104 |
| 26 | 3300042648 | Ga0466709_415522 | Ga0466709_415522_105408_105761 | 104 |
| 27 | 3300042592 | Ga0466693_079387 | Ga0466693_079387_819_1136 | 105 |
| 28 | 3300042607 | Ga0466720_091069 | Ga0466720_091069_18_335 | 105 |
| 29 | 3300042621 | Ga0466729_170993 | Ga0466729_170993_722_1081 | 105 |
| 30 | 3300010167 | Ga0123353_11206956 | Ga0123353_112069561 | 106 |
| 31 | 3300000062 | IMNBL1DRAFT_c0021942 | IMNBL1DRAFT_00219422 | 107 |
| 32 | 3300042643 | Ga0466704_053606 | Ga0466704_053606_9883_10239 | 107 |
| 33 | 3300042624 | Ga0466735_046572 | Ga0466735_046572_40_369 | 109 |
| 34 | 3300005200 | Ga0072940_1145539 | Ga0072940_11455392 | 112 |
| 35 | 3300009784 | Ga0123357_10055718 | Ga0123357_100557182 | 112 |
| 36 | 3300042590 | Ga0466690_252535 | Ga0466690_252535_5892_6233 | 113 |
| 37 | 3300042593 | Ga0466691_007363 | Ga0466691_007363_10510_10851 | 113 |
| 38 | 3300042618 | Ga0466723_368916 | Ga0466723_368916_2966_3307 | 113 |
| 39 | 3300042590 | Ga0466690_024376 | Ga0466690_024376_123_467 | 114 |
| 40 | 3300042636 | Ga0466703_216171 | Ga0466703_216171_391_735 | 114 |
| 41 | 3300002462 | JGI24702J35022_10183532 | JGI24702J35022_101835322 | 115 |
| 42 | 3300042591 | Ga0466692_013440 | Ga0466692_013440_15939_16289 | 116 |
| 43 | 3300042597 | Ga0466699_048170 | Ga0466699_048170_1965_2315 | 116 |
| 44 | 3300042601 | Ga0466707_150969 | Ga0466707_150969_23095_23445 | 116 |
| 45 | 3300042601 | Ga0466707_251501 | Ga0466707_251501_639_989 | 116 |
| 46 | 3300042601 | Ga0466707_266959 | Ga0466707_266959_2430_2780 | 116 |
| 47 | 3300042609 | Ga0466722_003345 | Ga0466722_003345_6178_6528 | 116 |
| 48 | 3300042609 | Ga0466722_165928 | Ga0466722_165928_177_527 | 116 |
| 49 | 3300042616 | Ga0466715_153338 | Ga0466715_153338_94368_94718 | 116 |
| 50 | 3300042643 | Ga0466704_306961 | Ga0466704_306961_3393_3743 | 116 |
| 51 | 2225789004 | 2227120014 | 2227512664 | 117 |
| 52 | 2225789004 | 2227589619 | 2228147191 | 117 |
| 53 | 3300002462 | JGI24702J35022_10138816 | JGI24702J35022_101388162 | 117 |
| 54 | 3300002504 | JGI24705J35276_11735273 | JGI24705J35276_117352731 | 117 |
| 55 | 3300010167 | Ga0123353_10002651 | Ga0123353_1000265119 | 117 |
| 56 | 3300010882 | Ga0123354_10479671 | Ga0123354_104796711 | 117 |
| 57 | 3300042582 | Ga0466657_180981 | Ga0466657_180981_2109_2462 | 117 |
| 58 | 3300042582 | Ga0466657_289838 | Ga0466657_289838_242_595 | 117 |
| 59 | 3300042590 | Ga0466690_016733 | Ga0466690_016733_1175_1528 | 117 |
| 60 | 3300042590 | Ga0466690_211524 | Ga0466690_211524_882_1235 | 117 |
| 61 | 3300042590 | Ga0466690_227385 | Ga0466690_227385_17012_17365 | 117 |
| 62 | 3300042591 | Ga0466692_124868 | Ga0466692_124868_5296_5649 | 117 |
| 63 | 3300042592 | Ga0466693_086622 | Ga0466693_086622_771_1124 | 117 |
| 64 | 3300042592 | Ga0466693_360315 | Ga0466693_360315_1143_1496 | 117 |
| 65 | 3300042595 | Ga0466695_012662 | Ga0466695_012662_598_951 | 117 |
| 66 | 3300042597 | Ga0466699_252379 | Ga0466699_252379_877_1230 | 117 |
| 67 | 3300042598 | Ga0466701_001524 | Ga0466701_001524_12057_12410 | 117 |
| 68 | 3300042598 | Ga0466701_076278 | Ga0466701_076278_1255_1608 | 117 |
| 69 | 3300042598 | Ga0466701_103328 | Ga0466701_103328_552_905 | 117 |
| 70 | 3300042600 | Ga0466700_251214 | Ga0466700_251214_379_732 | 117 |
| 71 | 3300042601 | Ga0466707_346591 | Ga0466707_346591_685_1038 | 117 |
| 72 | 3300042604 | Ga0466717_287231 | Ga0466717_287231_1999_2352 | 117 |
| 73 | 3300042605 | Ga0466716_202600 | Ga0466716_202600_8773_9126 | 117 |
| 74 | 3300042608 | Ga0466721_236764 | Ga0466721_236764_792_1145 | 117 |
| 75 | 3300042610 | Ga0466698_007777 | Ga0466698_007777_288_641 | 117 |
| 76 | 3300042610 | Ga0466698_489981 | Ga0466698_489981_188_541 | 117 |
| 77 | 3300042612 | Ga0466705_130431 | Ga0466705_130431_10947_11300 | 117 |
| 78 | 3300042613 | Ga0466710_075027 | Ga0466710_075027_442_795 | 117 |
| 79 | 3300042613 | Ga0466710_251195 | Ga0466710_251195_1052_1405 | 117 |
| 80 | 3300042613 | Ga0466710_370303 | Ga0466710_370303_2259_2612 | 117 |
| 81 | 3300042616 | Ga0466715_246897 | Ga0466715_246897_10048_10401 | 117 |
| 82 | 3300042619 | Ga0466726_364534 | Ga0466726_364534_158_511 | 117 |
| 83 | 3300042620 | Ga0466728_005858 | Ga0466728_005858_13718_14071 | 117 |
| 84 | 3300042620 | Ga0466728_046855 | Ga0466728_046855_14186_14539 | 117 |
| 85 | 3300042622 | Ga0466731_200235 | Ga0466731_200235_235_588 | 117 |
| 86 | 3300042622 | Ga0466731_358898 | Ga0466731_358898_30474_30827 | 117 |
| 87 | 3300042623 | Ga0466734_134187 | Ga0466734_134187_955_1308 | 117 |
| 88 | 3300042636 | Ga0466703_379471 | Ga0466703_379471_1878_2231 | 117 |
| 89 | 3300042643 | Ga0466704_353545 | Ga0466704_353545_1017_1370 | 117 |
| 90 | 3300042648 | Ga0466709_159378 | Ga0466709_159378_14940_15293 | 117 |
| 91 | 3300042654 | Ga0466725_103569 | Ga0466725_103569_420_773 | 117 |
| 92 | 3300042655 | Ga0466727_310729 | Ga0466727_310729_951_1304 | 117 |
| 93 | 3300042659 | Ga0466733_107037 | Ga0466733_107037_2203_2556 | 117 |
| 94 | 3300042659 | Ga0466733_193884 | Ga0466733_193884_201_554 | 117 |
| 95 | iso_pr_bacteria | 2820737921 | 2820738961 | 117 |
| 96 | iso_pr_bacteria | 2820797595 | 2820799660 | 117 |
| 97 | 3300000062 | IMNBL1DRAFT_c0045666 | IMNBL1DRAFT_00456662 | 118 |
| 98 | 3300002462 | JGI24702J35022_10001801 | JGI24702J35022_100018018 | 118 |
| 99 | 3300002462 | JGI24702J35022_10005913 | JGI24702J35022_100059131 | 118 |
| 100 | 3300002462 | JGI24702J35022_10386418 | JGI24702J35022_103864182 | 118 |
| 101 | 3300002462 | JGI24702J35022_10552504 | JGI24702J35022_105525041 | 118 |
| 102 | 3300002462 | JGI24702J35022_10811477 | JGI24702J35022_108114771 | 118 |
| 103 | 3300002834 | JGI24696J40584_12679684 | JGI24696J40584_126796842 | 118 |
| 104 | 3300002834 | JGI24696J40584_12769307 | JGI24696J40584_127693071 | 118 |
| 105 | 3300002834 | JGI24696J40584_12911467 | JGI24696J40584_129114672 | 118 |
| 106 | 3300002834 | JGI24696J40584_12918452 | JGI24696J40584_129184523 | 118 |
| 107 | 3300002834 | JGI24696J40584_12950850 | JGI24696J40584_129508504 | 118 |
| 108 | 3300002834 | JGI24696J40584_12956177 | JGI24696J40584_129561772 | 118 |
| 109 | 3300005083 | Ga0068305_10284588 | Ga0068305_102845881 | 118 |
| 110 | 3300005201 | Ga0072941_1162076 | Ga0072941_11620764 | 118 |
| 111 | 3300009784 | Ga0123357_10002196 | Ga0123357_100021969 | 118 |
| 112 | 3300009784 | Ga0123357_10345375 | Ga0123357_103453752 | 118 |
| 113 | 3300010049 | Ga0123356_10049878 | Ga0123356_100498784 | 118 |
| 114 | 3300010049 | Ga0123356_10651773 | Ga0123356_106517732 | 118 |
| 115 | 3300010049 | Ga0123356_11060309 | Ga0123356_110603092 | 118 |
| 116 | 3300010049 | Ga0123356_11192476 | Ga0123356_111924761 | 118 |
| 117 | 3300010049 | Ga0123356_11990634 | Ga0123356_119906342 | 118 |
| 118 | 3300010049 | Ga0123356_12552964 | Ga0123356_125529641 | 118 |
| 119 | 3300010049 | Ga0123356_13324812 | Ga0123356_133248121 | 118 |
| 120 | 3300010167 | Ga0123353_10039653 | Ga0123353_100396535 | 118 |
| 121 | 3300010882 | Ga0123354_10016193 | Ga0123354_100161935 | 118 |
| 122 | 3300010882 | Ga0123354_10021072 | Ga0123354_100210728 | 118 |
| 123 | 3300010882 | Ga0123354_10029114 | Ga0123354_100291142 | 118 |
| 124 | 3300010882 | Ga0123354_10271782 | Ga0123354_102717822 | 118 |
| 125 | 3300010882 | Ga0123354_10307308 | Ga0123354_103073081 | 118 |
| 126 | 3300010882 | Ga0123354_10358687 | Ga0123354_103586872 | 118 |
| 127 | 3300042607 | Ga0466720_205983 | Ga0466720_205983_1454_1810 | 118 |
| 128 | 3300042616 | Ga0466715_251026 | Ga0466715_251026_3214_3570 | 118 |
| 129 | 3300002462 | JGI24702J35022_10136998 | JGI24702J35022_101369982 | 119 |
| 130 | 3300002462 | JGI24702J35022_10016304 | JGI24702J35022_100163043 | 120 |
| 131 | 3300010167 | Ga0123353_10486968 | Ga0123353_104869683 | 122 |
| 132 | 3300010882 | Ga0123354_10284774 | Ga0123354_102847743 | 122 |
| 133 | 3300042594 | Ga0466694_294117 | Ga0466694_294117_469_843 | 124 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00892 | EamA | EamA-like transporter family | 53 | 122 | 0.78 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00892 | GO:0016020 | membrane | CC |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.7 | 0.72 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.