Protein Family IF05035

Metagenome Isolate
128 Members
43 Samples
124 Scaffolds
256.22 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_293843|Ga0466694_293843_1316_2218
Length
300 aa
Sequence
LKKLAHGGKESSDLFVLRGFAMNQDQVKEKLLLLEDAPLDFSVIFSGKKSKKVNGLYKNSSREIIIHNRNFSGGSGGKDADANLLIYTAIHEYAHHLHCCKSGGLLSSRAHTSEFWAILHGLLEKAEKKKIYRNVFFPSNGTGSKELEELTWTIKNKYLAENGKLVKELGQLLLKAYALCSAAGGRYEDYIDRILCIPRQAANLAVKMYQYDLNPEIGADNMRFLAGITNEEKRQVAESSLLNGKSPDMVKTALRKNTQEAKLDDVDPRLVLEKEKLRLERTIAALSKRLEEVKNELTKS

📊 Sample Types

Isolate 1.6%
Metagenome 98.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.9%
Kalotermitidae 32.6%
Rhinotermitidae 9.3%
Unclassified 7.0%
Termopsidae 7.0%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
14 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
15 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
28 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
38 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
39 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
40 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10355691 3300009784 Bacteria 1394
2 Ga0466690_423918 3300042590 Bacteria 1144
3 Ga0466694_341551 3300042594 Bacteria 1624
4 Ga0466694_377595 3300042594 Bacteria 1885
5 Ga0466699_222104 3300042597 Bacteria 2127
6 Ga0466700_402041 3300042600 Bacteria 1671
7 Ga0466716_434902 3300042605 Bacteria 3870
8 Ga0466735_179502 3300042624 Bacteria 1459
9 Ga0466703_098819 3300042636 Bacteria 20257
10 Ga0466703_418207 3300042636 Bacteria 3089
11 Ga0466704_037555 3300042643 Bacteria 8396
12 Ga0466704_374728 3300042643 Bacteria 3698
13 Ga0466709_009090 3300042648 Bacteria 27329
14 Ga0466709_079868 3300042648 Bacteria 3872
15 Ga0466708_100692 3300042652 Bacteria 1267
16 Ga0466718_136727 3300042617 Bacteria 1581
17 Ga0466723_005829 3300042618 Bacteria 4705
18 Ga0466726_364614 3300042619 Bacteria 2078
19 Ga0074263_102198 3300005485 Unclassified 1557
20 Ga0074263_108876 3300005485 Unclassified 3547
21 Ga0466732_154297 3300042656 Bacteria 5671
22 Ga0466690_350427 3300042590 Bacteria 1567
23 Ga0466696_064106 3300042596 Bacteria 1412
24 Ga0466696_226202 3300042596 Bacteria 3681
25 Ga0466707_115940 3300042601 Bacteria 1388
26 Ga0466719_047566 3300042606 Bacteria 14696
27 Ga0466720_228424 3300042607 Bacteria 12236
28 Ga0466704_106799 3300042643 Unclassified 4697
29 Ga0466708_222588 3300042652 Unclassified 6815
30 Ga0466715_132789 3300042616 Bacteria 29114
31 Ga0466715_351349 3300042616 Bacteria 8636
32 Ga0466705_020864 3300042612 Bacteria 24538
33 Ga0466705_187249 3300042612 Bacteria 3002
34 Ga0466690_251152 3300042590 Unclassified 4548
35 Ga0466691_013009 3300042593 Bacteria 2285
36 Ga0466691_227133 3300042593 Bacteria 8825
37 Ga0466717_127719 3300042604 Bacteria 1086
38 Ga0466719_316885 3300042606 Bacteria 4438
39 Ga0466720_079904 3300042607 Bacteria 1166
40 Ga0466720_125366 3300042607 Bacteria 14214
41 Ga0466720_150632 3300042607 Unclassified 2644
42 Ga0466703_025371 3300042636 Bacteria 12872
43 Ga0466703_311285 3300042636 Bacteria 9390
44 Ga0466708_035068 3300042652 Bacteria 6875
45 Ga0466708_164685 3300042652 Bacteria 38582
46 Ga0466727_123316 3300042655 Bacteria 7805
47 Ga0466718_037199 3300042617 Bacteria 3163
48 Ga0466723_129365 3300042618 Unclassified 2869
49 Ga0466723_288814 3300042618 Bacteria 13535
50 JGI24698J34947_10004191 3300002449 Unclassified 7838
51 JGI24698J34947_10035026 3300002449 Bacteria 2623
52 Ga0123355_10138825 3300009826 Bacteria 3726
53 Ga0123353_10468773 3300010167 Bacteria 1847
54 Ga0466692_204240 3300042591 Bacteria 36789
55 Ga0466694_027240 3300042594 Bacteria 14900
56 Ga0466694_409225 3300042594 Bacteria 36264
57 Ga0466695_028420 3300042595 Bacteria 3335
58 Ga0466699_242890 3300042597 Bacteria 1130
59 Ga0466716_379308 3300042605 Bacteria 9882
60 Ga0466703_028466 3300042636 Bacteria 10144
61 Ga0466704_253907 3300042643 Unclassified 7903
62 Ga0466712_058450 3300042614 Bacteria 7817
63 Ga0466726_040346 3300042619 Unclassified 1523
64 Ga0466728_145011 3300042620 Bacteria 10777
65 AustNasuHG_c1001012 3300000089 Bacteria 10135
66 JGI24698J34947_10004441 3300002449 Bacteria 7637
67 Ga0466705_255750 3300042612 Bacteria 3452
68 Ga0466692_041817 3300042591 Bacteria 11196
69 Ga0466699_265474 3300042597 Bacteria 9682
70 Ga0466698_311808 3300042610 Bacteria 1277
71 Ga0466735_028152 3300042624 Bacteria 4244
72 Ga0466735_049795 3300042624 Unclassified 1147
73 Ga0466703_014921 3300042636 Bacteria 7407
74 Ga0466708_153922 3300042652 Bacteria 2044
75 Ga0466711_331291 3300042615 Bacteria 4643
76 Ga0466715_237052 3300042616 Bacteria 14138
77 Ga0466726_193954 3300042619 Bacteria 2479
78 JGI24698J34947_10046323 3300002449 Unclassified 2213
79 Ga0466705_055565 3300042612 Bacteria 1674
80 Ga0466694_293843 3300042594 Bacteria 2388
81 Ga0466699_179747 3300042597 Bacteria 2373
82 Ga0466706_104853 3300042599 Bacteria 11742
83 Ga0466720_010019 3300042607 Bacteria 9693
84 Ga0466722_015416 3300042609 Bacteria 6021
85 Ga0466729_313128 3300042621 Bacteria 1146
86 Ga0466711_201130 3300042615 Bacteria 2260
87 Ga0466723_123393 3300042618 Bacteria 21773
88 Ga0466726_389584 3300042619 Bacteria 26574
89 Ga0466728_002750 3300042620 Bacteria 5051
90 JGI24698J34947_10005775 3300002449 Bacteria 6786
91 Ga0466705_237181 3300042612 Bacteria 4225
92 Ga0466732_427349 3300042656 Bacteria 2817
93 Ga0123357_10058816 3300009784 Bacteria 5159
94 Ga0123353_10425158 3300010167 Bacteria 1967
95 Ga0456237_0000533 3300041968 Bacteria 5798
96 Ga0466690_035321 3300042590 Bacteria 5242
97 Ga0466691_054723 3300042593 Bacteria 13333
98 Ga0466694_100808 3300042594 Bacteria 7330
99 Ga0466694_267007 3300042594 Unclassified 3127
100 Ga0466696_016858 3300042596 Bacteria 8735
101 Ga0466696_187794 3300042596 Bacteria 6395
102 Ga0466706_200433 3300042599 Bacteria 1628
103 Ga0466698_200164 3300042610 Bacteria 4193
104 Ga0466712_069687 3300042614 Bacteria 15367
105 Ga0466712_189763 3300042614 Bacteria 10684
106 Ga0466723_141152 3300042618 Bacteria 3940
107 Ga0466726_423132 3300042619 Bacteria 1073
108 Ga0123353_10841783 3300010167 Bacteria 1259
109 Ga0466692_097831 3300042591 Bacteria 11967
110 Ga0466692_159711 3300042591 Bacteria 7211
111 Ga0466699_010407 3300042597 Bacteria 6309
112 Ga0466706_023038 3300042599 Bacteria 3450
113 Ga0466719_010034 3300042606 Bacteria 4144
114 Ga0466720_049890 3300042607 Bacteria 1557
115 Ga0466720_107601 3300042607 Bacteria 2457
116 Ga0466720_213180 3300042607 Bacteria 1776
117 Ga0466731_106106 3300042622 Bacteria 2146
118 Ga0466709_037095 3300042648 Bacteria 3010
119 Ga0466708_283267 3300042652 Bacteria 8379
120 Ga0466711_076850 3300042615 Bacteria 18451
121 Ga0466726_494422 3300042619 Bacteria 1194
122 Ga0466728_247086 3300042620 Unclassified 2127
123 Ga0466729_088895 3300042621 Bacteria 5314
124 JGI24702J35022_10023330 3300002462 Bacteria 3346

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042621 Ga0466729_313128 Ga0466729_313128_398_1132 226
2 3300042593 Ga0466691_013009 Ga0466691_013009_703_1488 232
3 3300042616 Ga0466715_351349 Ga0466715_351349_3971_4759 233
4 3300042607 Ga0466720_213180 Ga0466720_213180_621_1406 234
5 3300042618 Ga0466723_005829 Ga0466723_005829_1442_2248 234
6 3300042591 Ga0466692_097831 Ga0466692_097831_3381_4166 235
7 3300042636 Ga0466703_028466 Ga0466703_028466_2314_3102 235
8 3300042612 Ga0466705_020864 Ga0466705_020864_10787_11572 236
9 3300042636 Ga0466703_025371 Ga0466703_025371_7053_7841 236
10 3300042652 Ga0466708_222588 Ga0466708_222588_2473_3267 238
11 3300042643 Ga0466704_253907 Ga0466704_253907_3661_4449 239
12 3300042652 Ga0466708_164685 Ga0466708_164685_31566_32360 239
13 3300042590 Ga0466690_035321 Ga0466690_035321_1357_2148 240
14 3300042590 Ga0466690_350427 Ga0466690_350427_724_1512 240
15 3300042596 Ga0466696_016858 Ga0466696_016858_3107_3901 240
16 3300042596 Ga0466696_064106 Ga0466696_064106_340_1134 240
17 3300042615 Ga0466711_201130 Ga0466711_201130_679_1467 240
18 3300042620 Ga0466728_002750 Ga0466728_002750_1747_2535 240
19 3300042643 Ga0466704_037555 Ga0466704_037555_5090_5875 240
20 3300042643 Ga0466704_106799 Ga0466704_106799_2208_2993 240
21 3300042618 Ga0466723_123393 Ga0466723_123393_19991_20791 241
22 3300042618 Ga0466723_288814 Ga0466723_288814_4492_5283 241
23 3300042648 Ga0466709_009090 Ga0466709_009090_8184_8978 241
24 3300042636 Ga0466703_311285 Ga0466703_311285_6520_7311 242
25 3300042595 Ga0466695_028420 Ga0466695_028420_434_1249 243
26 3300042597 Ga0466699_242890 Ga0466699_242890_273_1076 243
27 3300042652 Ga0466708_100692 Ga0466708_100692_246_1061 243
28 3300042593 Ga0466691_227133 Ga0466691_227133_4884_5675 244
29 3300042601 Ga0466707_115940 Ga0466707_115940_385_1170 244
30 3300042606 Ga0466719_316885 Ga0466719_316885_2797_3630 244
31 3300042607 Ga0466720_125366 Ga0466720_125366_10668_11465 244
32 3300042619 Ga0466726_389584 Ga0466726_389584_1248_2051 244
33 3300042590 Ga0466690_423918 Ga0466690_423918_47_850 245
34 3300042594 Ga0466694_341551 Ga0466694_341551_277_1071 245
35 3300042616 Ga0466715_132789 Ga0466715_132789_15964_16767 245
36 3300042636 Ga0466703_014921 Ga0466703_014921_2185_2976 245
37 3300042636 Ga0466703_418207 Ga0466703_418207_2125_2916 245
38 3300042596 Ga0466696_226202 Ga0466696_226202_1827_2657 246
39 3300042606 Ga0466719_047566 Ga0466719_047566_8041_8832 246
40 3300042612 Ga0466705_055565 Ga0466705_055565_414_1199 246
41 3300042612 Ga0466705_237181 Ga0466705_237181_2936_3724 246
42 3300042617 Ga0466718_037199 Ga0466718_037199_920_1717 246
43 3300042643 Ga0466704_374728 Ga0466704_374728_2084_2893 246
44 3300042609 Ga0466722_015416 Ga0466722_015416_1762_2565 247
45 3300042652 Ga0466708_153922 Ga0466708_153922_787_1578 247
46 3300005485 Ga0074263_102198 Ga0074263_1021982 248
47 3300042599 Ga0466706_023038 Ga0466706_023038_2421_3248 248
48 3300042605 Ga0466716_434902 Ga0466716_434902_1283_2086 248
49 3300042612 Ga0466705_255750 Ga0466705_255750_1641_2504 248
50 3300042655 Ga0466727_123316 Ga0466727_123316_3061_3852 248
51 3300042605 Ga0466716_379308 Ga0466716_379308_7772_8566 249
52 3300042619 Ga0466726_364614 Ga0466726_364614_266_1090 249
53 3300042607 Ga0466720_079904 Ga0466720_079904_73_870 250
54 3300042624 Ga0466735_179502 Ga0466735_179502_583_1371 251
55 3300042652 Ga0466708_035068 Ga0466708_035068_181_966 251
56 3300042612 Ga0466705_187249 Ga0466705_187249_946_1737 252
57 3300042599 Ga0466706_104853 Ga0466706_104853_8291_9136 255
58 3300042606 Ga0466719_010034 Ga0466719_010034_1731_2525 256
59 3300042616 Ga0466715_237052 Ga0466715_237052_2901_3737 256
60 3300042599 Ga0466706_200433 Ga0466706_200433_683_1495 257
61 3300042618 Ga0466723_141152 Ga0466723_141152_323_1123 257
62 3300042619 Ga0466726_494422 Ga0466726_494422_86_928 257
63 3300042590 Ga0466690_251152 Ga0466690_251152_794_1597 258
64 3300042590 Ga0466690_251152 Ga0466690_251152_794_1597 258
65 3300042590 Ga0466690_251152 Ga0466690_251152_794_1597 258
66 3300042600 Ga0466700_402041 Ga0466700_402041_396_1199 260
67 3300042614 Ga0466712_069687 Ga0466712_069687_4753_5565 260
68 3300042615 Ga0466711_076850 Ga0466711_076850_2959_3741 260
69 3300042619 Ga0466726_040346 Ga0466726_040346_630_1463 260
70 3300041968 Ga0456237_0000533 Ga0456237_0000533_2936_3721 261
71 3300042607 Ga0466720_107601 Ga0466720_107601_313_1098 261
72 3300042607 Ga0466720_150632 Ga0466720_150632_1451_2236 261
73 3300042607 Ga0466720_228424 Ga0466720_228424_11172_11957 261
74 3300042615 Ga0466711_331291 Ga0466711_331291_2325_3110 261
75 3300042617 Ga0466718_136727 Ga0466718_136727_728_1513 261
76 3300042648 Ga0466709_037095 Ga0466709_037095_650_1435 261
77 3300042652 Ga0466708_283267 Ga0466708_283267_5224_6009 261
78 3300042656 Ga0466732_427349 Ga0466732_427349_664_1449 261
79 3300005485 Ga0074263_108876 Ga0074263_1088764 262
80 3300010167 Ga0123353_10841783 Ga0123353_108417832 262
81 3300042591 Ga0466692_159711 Ga0466692_159711_1307_2116 263
82 3300042614 Ga0466712_058450 Ga0466712_058450_3604_4416 263
83 3300042619 Ga0466726_193954 Ga0466726_193954_825_1616 263
84 3300042597 Ga0466699_265474 Ga0466699_265474_1786_2583 265
85 3300042607 Ga0466720_010019 Ga0466720_010019_79_876 265
86 3300042607 Ga0466720_049890 Ga0466720_049890_746_1543 265
87 3300042619 Ga0466726_423132 Ga0466726_423132_181_978 265
88 3300042620 Ga0466728_145011 Ga0466728_145011_7381_8178 265
89 3300042624 Ga0466735_028152 Ga0466735_028152_3087_3884 265
90 3300042624 Ga0466735_049795 Ga0466735_049795_308_1105 265
91 3300000089 AustNasuHG_c1001012 AustNasuHG_10010121 266
92 3300042591 Ga0466692_041817 Ga0466692_041817_1517_2317 266
93 3300042591 Ga0466692_204240 Ga0466692_204240_3304_4197 266
94 3300042594 Ga0466694_027240 Ga0466694_027240_8081_8881 266
95 3300042594 Ga0466694_377595 Ga0466694_377595_307_1107 266
96 3300042604 Ga0466717_127719 Ga0466717_127719_189_989 266
97 3300010167 Ga0123353_10468773 Ga0123353_104687731 267
98 3300042593 Ga0466691_054723 Ga0466691_054723_309_1112 267
99 3300042594 Ga0466694_409225 Ga0466694_409225_25092_25895 267
100 3300042597 Ga0466699_010407 Ga0466699_010407_4621_5424 267
101 3300042597 Ga0466699_222104 Ga0466699_222104_613_1416 267
102 3300042610 Ga0466698_200164 Ga0466698_200164_2158_2961 267
103 3300042618 Ga0466723_129365 Ga0466723_129365_1877_2680 267
104 3300042648 Ga0466709_079868 Ga0466709_079868_870_1676 268
105 iso_pr_bacteria 2781125692 2781432146 268
106 3300010167 Ga0123353_10425158 Ga0123353_104251582 269
107 3300042596 Ga0466696_187794 Ga0466696_187794_844_1653 269
108 3300042597 Ga0466699_179747 Ga0466699_179747_284_1093 269
109 3300042636 Ga0466703_098819 Ga0466703_098819_13442_14251 269
110 3300002449 JGI24698J34947_10035026 JGI24698J34947_100350262 270
111 3300042594 Ga0466694_100808 Ga0466694_100808_1590_2402 270
112 3300042614 Ga0466712_189763 Ga0466712_189763_750_1562 270
113 3300042656 Ga0466732_154297 Ga0466732_154297_1332_2144 270
114 3300002449 JGI24698J34947_10004191 JGI24698J34947_100041916 271
115 3300002449 JGI24698J34947_10004441 JGI24698J34947_100044413 271
116 3300002449 JGI24698J34947_10005775 JGI24698J34947_100057758 271
117 3300002449 JGI24698J34947_10046323 JGI24698J34947_100463232 271
118 3300042620 Ga0466728_247086 Ga0466728_247086_1064_1882 272
119 3300042621 Ga0466729_088895 Ga0466729_088895_659_1480 273
120 iso_pr_bacteria 2781125666 2781346154 274
121 3300009784 Ga0123357_10058816 Ga0123357_100588164 275
122 3300042610 Ga0466698_311808 Ga0466698_311808_321_1151 276
123 3300009784 Ga0123357_10355691 Ga0123357_103556912 278
124 3300009826 Ga0123355_10138825 Ga0123355_101388253 279
125 3300002462 JGI24702J35022_10023330 JGI24702J35022_100233303 280
126 3300042622 Ga0466731_106106 Ga0466731_106106_1257_2129 290
127 3300042594 Ga0466694_293843 Ga0466694_293843_1316_2218 300
128 3300042594 Ga0466694_267007 Ga0466694_267007_905_1810 301

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.