Protein Family IF05029

Metagenome Isolate
141 Members
33 Samples
140 Scaffolds
106.97 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_271487|Ga0466694_271487_515_844
Length
102 aa
Sequence
MGLVMEQYSICLVNLEPSIGHEIKKTRPCVIISPNEMNQHIMTTKSHAYPTRVPLTFQGKKGWIVLDQIRTVDKRRIIKKLGKLTSNKITEVKNIINEMLVE

📊 Sample Types

Isolate 0.7%
Metagenome 99.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 73.3%
Kalotermitidae 10.0%
Termopsidae 10.0%
Unclassified 6.7%

🌳 Taxonomy

Archaea 2
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 31

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
20 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
21 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
22 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
26 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
27 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
28 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_254485 3300042656 Bacteria 1097
2 Ga0264413_100883 3300024493 Bacteria 42424
3 Ga0466694_051305 3300042594 Bacteria 5377
4 AustNasuHG_c1018264 3300000089 Bacteria 2318
5 AustNasuHG_c1051377 3300000089 Unclassified 877
6 JGI24698J34947_10006536 3300002449 Bacteria 6398
7 JGI24698J34947_10071523 3300002449 Unclassified 1664
8 JGI24698J34947_10100166 3300002449 Bacteria 1305
9 JGI24698J34947_10314592 3300002449 Bacteria 559
10 JGI24695J34938_10001573 3300002450 Bacteria 19221
11 JGI24702J35022_10065055 3300002462 Bacteria 1956
12 JGI24696J40584_12951336 3300002834 Bacteria 2233
13 Ga0072940_1139372 3300005200 Unclassified 1249
14 Ga0466712_012588 3300042614 Bacteria 1967
15 Ga0466712_081897 3300042614 Bacteria 8697
16 Ga0466718_158902 3300042617 Unclassified 4037
17 Ga0466702_136951 3300042635 Bacteria 1132
18 Ga0466702_370613 3300042635 Unclassified 1311
19 Ga0466727_208699 3300042655 Bacteria 9767
20 Ga0466720_203269 3300042607 Bacteria 1777
21 Ga0466732_213060 3300042656 Archaea 7062
22 Ga0264413_120926 3300024493 Bacteria 1360
23 Ga0466690_254894 3300042590 Bacteria 2208
24 AustNasuHG_c1042371 3300000089 Bacteria 1084
25 JGI24695J34938_10006294 3300002450 Bacteria 7183
26 Ga0072941_1038330 3300005201 Bacteria 3532
27 Ga0466712_145146 3300042614 Bacteria 2587
28 Ga0466712_188420 3300042614 Bacteria 6034
29 Ga0466715_187254 3300042616 Bacteria 3946
30 Ga0466718_019708 3300042617 Bacteria 18835
31 Ga0466718_029097 3300042617 Unclassified 8123
32 Ga0466718_059094 3300042617 Bacteria 1533
33 Ga0466708_074415 3300042652 Unclassified 1753
34 Ga0466720_036539 3300042607 Unclassified 1789
35 Ga0466720_122527 3300042607 Bacteria 2064
36 Ga0466720_148186 3300042607 Bacteria 6706
37 Ga0466721_225174 3300042608 Bacteria 32299
38 Ga0466698_273433 3300042610 Bacteria 2068
39 Ga0466732_319319 3300042656 Bacteria 1590
40 Ga0466732_382113 3300042656 Bacteria 18383
41 Ga0123357_10773424 3300009784 Bacteria 659
42 Ga0123353_10479072 3300010167 Bacteria 1821
43 Ga0123353_11606671 3300010167 Bacteria 821
44 AustNasuHG_c1075072 3300000089 Unclassified 592
45 JGI24698J34947_10025002 3300002449 Bacteria 3182
46 JGI24698J34947_10134469 3300002449 Bacteria 1052
47 JGI24698J34947_10286439 3300002449 Bacteria 600
48 Ga0466712_019849 3300042614 Bacteria 3200
49 Ga0466700_305532 3300042600 Bacteria 1910
50 Ga0466707_153659 3300042601 Bacteria 1536
51 Ga0466720_206285 3300042607 Bacteria 2817
52 Ga0123355_12145442 3300009826 Bacteria 512
53 Ga0123356_10390562 3300010049 Unclassified 1527
54 Ga0123356_10615425 3300010049 Bacteria 1251
55 Ga0123353_11762558 3300010167 Bacteria 772
56 Ga0264413_113541 3300024493 Bacteria 3195
57 Ga0466694_018450 3300042594 Bacteria 43707
58 AustNasuHG_c1035162 3300000089 Bacteria 1325
59 JGI24698J34947_10000374 3300002449 Bacteria 20110
60 JGI24698J34947_10062376 3300002449 Bacteria 1830
61 Ga0466712_009738 3300042614 Bacteria 1155
62 Ga0466712_107930 3300042614 Unclassified 2347
63 Ga0466715_045708 3300042616 Bacteria 39702
64 Ga0466718_051732 3300042617 Bacteria 3673
65 Ga0466718_117446 3300042617 Bacteria 1099
66 Ga0466707_028122 3300042601 Archaea 2029
67 Ga0466720_072162 3300042607 Bacteria 7077
68 Ga0123357_10407977 3300009784 Bacteria 1228
69 Ga0123353_10536729 3300010167 Bacteria 1692
70 Ga0123353_12371352 3300010167 Bacteria 636
71 Ga0264413_133966 3300024493 Unclassified 1031
72 Ga0466694_271487 3300042594 Bacteria 1071
73 Ga0466699_073492 3300042597 Bacteria 3531
74 AustNasuHG_c1021757 3300000089 Bacteria 2070
75 FAAS_10351970 3300001880 Bacteria 541
76 JGI24698J34947_10039961 3300002449 Bacteria 2425
77 JGI24698J34947_10110639 3300002449 Bacteria 1213
78 JGI24698J34947_10236001 3300002449 Unclassified 692
79 Ga0466712_006332 3300042614 Unclassified 1881
80 Ga0466712_009306 3300042614 Unclassified 8618
81 Ga0466712_161488 3300042614 Bacteria 2390
82 Ga0466712_199313 3300042614 Unclassified 2121
83 Ga0466718_097301 3300042617 Bacteria 1039
84 Ga0466735_144648 3300042624 Bacteria 1014
85 Ga0466720_066961 3300042607 Bacteria 14297
86 Ga0466720_076955 3300042607 Bacteria 2349
87 Ga0466720_149081 3300042607 Bacteria 75517
88 Ga0466720_207068 3300042607 Unclassified 2028
89 Ga0466732_345681 3300042656 Bacteria 9324
90 Ga0466732_391645 3300042656 Bacteria 3036
91 Ga0123357_10035422 3300009784 Bacteria 6786
92 Ga0123356_10700679 3300010049 Unclassified 1182
93 Ga0264413_126644 3300024493 Unclassified 2804
94 Ga0466693_369496 3300042592 Bacteria 1465
95 AustNasuHG_c1001174 3300000089 Bacteria 9408
96 AustNasuHG_c1029622 3300000089 Unclassified 1597
97 FAAS_10579152 3300001880 Unclassified 524
98 JGI24698J34947_10036105 3300002449 Unclassified 2575
99 JGI24698J34947_10197907 3300002449 Unclassified 789
100 JGI24695J34938_10005234 3300002450 Bacteria 8177
101 JGI24695J34938_10205619 3300002450 Bacteria 822
102 Ga0072940_1022527 3300005200 Bacteria 6111
103 Ga0072940_1117403 3300005200 Bacteria 789
104 Ga0466718_014411 3300042617 Bacteria 1386
105 Ga0466718_050990 3300042617 Unclassified 1680
106 Ga0466718_054558 3300042617 Bacteria 23512
107 Ga0466702_418100 3300042635 Bacteria 1369
108 Ga0466727_170053 3300042655 Bacteria 2985
109 Ga0466707_076811 3300042601 Bacteria 2730
110 Ga0466720_040357 3300042607 Bacteria 25359
111 Ga0466698_182993 3300042610 Bacteria 2882
112 Ga0123353_12057996 3300010167 Bacteria 697
113 Ga0123354_10118317 3300010882 Unclassified 3441
114 Ga0264413_103890 3300024493 Bacteria 7028
115 Ga0466694_093765 3300042594 Bacteria 40261
116 AustNasuHG_c1025212 3300000089 Bacteria 1872
117 JGI24698J34947_10001711 3300002449 Unclassified 11685
118 JGI24698J34947_10002446 3300002449 Bacteria 10005
119 JGI24698J34947_10002872 3300002449 Bacteria 9347
120 JGI24698J34947_10288204 3300002449 Bacteria 597
121 Ga0072940_1023916 3300005200 Unclassified 1866
122 Ga0072940_1032669 3300005200 Unclassified 2008
123 Ga0072940_1088418 3300005200 Bacteria 806
124 Ga0466718_045188 3300042617 Bacteria 1051
125 Ga0466727_300820 3300042655 Bacteria 3162
126 Ga0123353_10523256 3300010167 Bacteria 1720
127 Ga0123353_11205317 3300010167 Bacteria 993
128 Ga0123353_11922452 3300010167 Bacteria 729
129 Ga0264413_110642 3300024493 Unclassified 3692
130 Ga0466694_334975 3300042594 Bacteria 6999
131 AustNasuHG_c1002394 3300000089 Bacteria 6772
132 Ga0466712_000188 3300042614 Bacteria 6847
133 Ga0466712_180166 3300042614 Unclassified 1160
134 Ga0466712_226367 3300042614 Bacteria 4401
135 Ga0466712_286235 3300042614 Bacteria 1402
136 Ga0466718_013780 3300042617 Bacteria 1280
137 Ga0466718_026871 3300042617 Bacteria 1201
138 Ga0466726_364058 3300042619 Bacteria 1306
139 Ga0466720_232163 3300042607 Unclassified 7266
140 Ga0466720_234123 3300042607 Bacteria 2815

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000089 AustNasuHG_c1018264 AustNasuHG_10182643 93
2 3300001880 FAAS_10579152 FAAS_105791521 94
3 3300042614 Ga0466712_286235 Ga0466712_286235_815_1144 94
4 3300042635 Ga0466702_136951 Ga0466702_136951_812_1105 97
5 3300042594 Ga0466694_271487 Ga0466694_271487_515_844 102
6 3300024493 Ga0264413_100883 Ga0264413_10088343 105
7 3300024493 Ga0264413_103890 Ga0264413_1038908 105
8 3300024493 Ga0264413_113541 Ga0264413_1135411 105
9 3300024493 Ga0264413_133966 Ga0264413_1339662 105
10 3300042594 Ga0466694_334975 Ga0466694_334975_461_778 105
11 3300042601 Ga0466707_028122 Ga0466707_028122_445_762 105
12 3300042607 Ga0466720_232163 Ga0466720_232163_6394_6711 105
13 3300042607 Ga0466720_234123 Ga0466720_234123_304_621 105
14 3300042614 Ga0466712_006332 Ga0466712_006332_502_819 105
15 3300042614 Ga0466712_012588 Ga0466712_012588_971_1288 105
16 3300042616 Ga0466715_187254 Ga0466715_187254_2659_2976 105
17 3300042617 Ga0466718_013780 Ga0466718_013780_763_1080 105
18 3300042617 Ga0466718_014411 Ga0466718_014411_59_376 105
19 3300042617 Ga0466718_026871 Ga0466718_026871_272_589 105
20 3300042617 Ga0466718_029097 Ga0466718_029097_3236_3553 105
21 3300042617 Ga0466718_045188 Ga0466718_045188_491_808 105
22 3300042617 Ga0466718_050990 Ga0466718_050990_368_685 105
23 3300042617 Ga0466718_059094 Ga0466718_059094_795_1112 105
24 3300042617 Ga0466718_097301 Ga0466718_097301_392_709 105
25 3300042617 Ga0466718_117446 Ga0466718_117446_18_335 105
26 3300042617 Ga0466718_158902 Ga0466718_158902_3670_3987 105
27 3300042635 Ga0466702_370613 Ga0466702_370613_391_708 105
28 3300042652 Ga0466708_074415 Ga0466708_074415_258_575 105
29 3300042656 Ga0466732_254485 Ga0466732_254485_615_932 105
30 3300042656 Ga0466732_319319 Ga0466732_319319_277_594 105
31 3300042656 Ga0466732_345681 Ga0466732_345681_8554_8871 105
32 3300042656 Ga0466732_391645 Ga0466732_391645_2137_2454 105
33 3300000089 AustNasuHG_c1001174 AustNasuHG_10011742 106
34 3300000089 AustNasuHG_c1021757 AustNasuHG_10217573 106
35 3300000089 AustNasuHG_c1029622 AustNasuHG_10296222 106
36 3300000089 AustNasuHG_c1035162 AustNasuHG_10351624 106
37 3300000089 AustNasuHG_c1051377 AustNasuHG_10513773 106
38 3300000089 AustNasuHG_c1075072 AustNasuHG_10750722 106
39 3300001880 FAAS_10351970 FAAS_103519701 106
40 3300002449 JGI24698J34947_10001711 JGI24698J34947_100017113 106
41 3300002449 JGI24698J34947_10002446 JGI24698J34947_100024467 106
42 3300002449 JGI24698J34947_10002872 JGI24698J34947_1000287212 106
43 3300002449 JGI24698J34947_10036105 JGI24698J34947_100361053 106
44 3300002449 JGI24698J34947_10039961 JGI24698J34947_100399611 106
45 3300002449 JGI24698J34947_10071523 JGI24698J34947_100715233 106
46 3300002449 JGI24698J34947_10100166 JGI24698J34947_101001661 106
47 3300002449 JGI24698J34947_10134469 JGI24698J34947_101344693 106
48 3300002449 JGI24698J34947_10197907 JGI24698J34947_101979072 106
49 3300002449 JGI24698J34947_10236001 JGI24698J34947_102360012 106
50 3300002450 JGI24695J34938_10005234 JGI24695J34938_100052341 106
51 3300002450 JGI24695J34938_10205619 JGI24695J34938_102056191 106
52 3300002462 JGI24702J35022_10065055 JGI24702J35022_100650551 106
53 3300002834 JGI24696J40584_12951336 JGI24696J40584_129513365 106
54 3300005200 Ga0072940_1022527 Ga0072940_10225275 106
55 3300005200 Ga0072940_1023916 Ga0072940_10239163 106
56 3300005200 Ga0072940_1032669 Ga0072940_10326692 106
57 3300005200 Ga0072940_1088418 Ga0072940_10884182 106
58 3300005200 Ga0072940_1139372 Ga0072940_11393722 106
59 3300005201 Ga0072941_1038330 Ga0072941_10383302 106
60 3300009784 Ga0123357_10035422 Ga0123357_100354224 106
61 3300009784 Ga0123357_10407977 Ga0123357_104079772 106
62 3300009784 Ga0123357_10773424 Ga0123357_107734242 106
63 3300009826 Ga0123355_12145442 Ga0123355_121454421 106
64 3300010049 Ga0123356_10390562 Ga0123356_103905622 106
65 3300010049 Ga0123356_10615425 Ga0123356_106154253 106
66 3300010167 Ga0123353_10479072 Ga0123353_104790722 106
67 3300010167 Ga0123353_10523256 Ga0123353_105232562 106
68 3300010167 Ga0123353_10536729 Ga0123353_105367293 106
69 3300010167 Ga0123353_11205317 Ga0123353_112053172 106
70 3300010167 Ga0123353_11606671 Ga0123353_116066711 106
71 3300010167 Ga0123353_11922452 Ga0123353_119224522 106
72 3300010167 Ga0123353_12057996 Ga0123353_120579962 106
73 3300010167 Ga0123353_12371352 Ga0123353_123713522 106
74 3300010882 Ga0123354_10118317 Ga0123354_101183172 106
75 3300002449 JGI24698J34947_10110639 JGI24698J34947_101106392 107
76 3300042601 Ga0466707_076811 Ga0466707_076811_759_1082 107
77 3300042601 Ga0466707_153659 Ga0466707_153659_278_601 107
78 3300042624 Ga0466735_144648 Ga0466735_144648_193_516 107
79 3300042655 Ga0466727_170053 Ga0466727_170053_375_698 107
80 3300010049 Ga0123356_10700679 Ga0123356_107006792 108
81 3300010167 Ga0123353_11762558 Ga0123353_117625582 108
82 3300042590 Ga0466690_254894 Ga0466690_254894_736_1062 108
83 3300042617 Ga0466718_019708 Ga0466718_019708_3808_4134 108
84 3300002449 JGI24698J34947_10025002 JGI24698J34947_100250023 109
85 3300024493 Ga0264413_126644 Ga0264413_1266444 109
86 3300042594 Ga0466694_018450 Ga0466694_018450_9274_9603 109
87 3300042594 Ga0466694_093765 Ga0466694_093765_25089_25418 109
88 3300042600 Ga0466700_305532 Ga0466700_305532_794_1123 109
89 3300042607 Ga0466720_036539 Ga0466720_036539_110_439 109
90 3300042607 Ga0466720_040357 Ga0466720_040357_697_1026 109
91 3300042607 Ga0466720_066961 Ga0466720_066961_6379_6708 109
92 3300042607 Ga0466720_072162 Ga0466720_072162_463_792 109
93 3300042607 Ga0466720_076955 Ga0466720_076955_1111_1440 109
94 3300042607 Ga0466720_122527 Ga0466720_122527_548_877 109
95 3300042607 Ga0466720_148186 Ga0466720_148186_6174_6503 109
96 3300042607 Ga0466720_203269 Ga0466720_203269_1209_1538 109
97 3300042607 Ga0466720_206285 Ga0466720_206285_1258_1587 109
98 3300042607 Ga0466720_207068 Ga0466720_207068_1228_1557 109
99 3300042608 Ga0466721_225174 Ga0466721_225174_1259_1588 109
100 3300042610 Ga0466698_182993 Ga0466698_182993_1798_2127 109
101 3300042610 Ga0466698_273433 Ga0466698_273433_1060_1389 109
102 3300042614 Ga0466712_009738 Ga0466712_009738_145_474 109
103 3300042614 Ga0466712_019849 Ga0466712_019849_2230_2559 109
104 3300042614 Ga0466712_107930 Ga0466712_107930_581_910 109
105 3300042614 Ga0466712_145146 Ga0466712_145146_536_865 109
106 3300042614 Ga0466712_161488 Ga0466712_161488_1686_2015 109
107 3300042614 Ga0466712_180166 Ga0466712_180166_467_796 109
108 3300042614 Ga0466712_188420 Ga0466712_188420_5042_5371 109
109 3300042614 Ga0466712_199313 Ga0466712_199313_1051_1380 109
110 3300042614 Ga0466712_226367 Ga0466712_226367_2440_2769 109
111 3300042616 Ga0466715_045708 Ga0466715_045708_38786_39115 109
112 3300042617 Ga0466718_051732 Ga0466718_051732_120_449 109
113 3300042617 Ga0466718_054558 Ga0466718_054558_7953_8282 109
114 3300042619 Ga0466726_364058 Ga0466726_364058_919_1248 109
115 3300042635 Ga0466702_418100 Ga0466702_418100_463_792 109
116 3300042655 Ga0466727_208699 Ga0466727_208699_8179_8508 109
117 3300042655 Ga0466727_300820 Ga0466727_300820_2728_3057 109
118 3300042656 Ga0466732_382113 Ga0466732_382113_17516_17845 109
119 iso_pr_bacteria 2781125687 2781421592 109
120 3300000089 AustNasuHG_c1002394 AustNasuHG_10023948 110
121 3300000089 AustNasuHG_c1025212 AustNasuHG_10252122 110
122 3300002449 JGI24698J34947_10000374 JGI24698J34947_1000037411 110
123 3300002449 JGI24698J34947_10006536 JGI24698J34947_100065366 110
124 3300002449 JGI24698J34947_10062376 JGI24698J34947_100623763 110
125 3300002449 JGI24698J34947_10286439 JGI24698J34947_102864392 110
126 3300002449 JGI24698J34947_10288204 JGI24698J34947_102882041 110
127 3300002449 JGI24698J34947_10314592 JGI24698J34947_103145922 110
128 3300002450 JGI24695J34938_10001573 JGI24695J34938_100015737 110
129 3300002450 JGI24695J34938_10006294 JGI24695J34938_100062948 110
130 3300024493 Ga0264413_110642 Ga0264413_1106423 110
131 3300024493 Ga0264413_120926 Ga0264413_1209262 110
132 3300042594 Ga0466694_051305 Ga0466694_051305_2075_2407 110
133 3300042597 Ga0466699_073492 Ga0466699_073492_17_349 110
134 3300042607 Ga0466720_149081 Ga0466720_149081_6988_7320 110
135 3300042614 Ga0466712_000188 Ga0466712_000188_4179_4511 110
136 3300042614 Ga0466712_009306 Ga0466712_009306_2315_2647 110
137 3300042614 Ga0466712_081897 Ga0466712_081897_1674_2006 110
138 3300042656 Ga0466732_213060 Ga0466732_213060_3675_4007 110
139 3300000089 AustNasuHG_c1042371 AustNasuHG_10423712 111
140 3300005200 Ga0072940_1117403 Ga0072940_11174032 111
141 3300042592 Ga0466693_369496 Ga0466693_369496_164_505 113

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system 7 100 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02452 GO:0003677 DNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.6 0.62 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.