Protein Family IF05021

Metagenome Isolate
125 Members
36 Samples
123 Scaffolds
254.68 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_231812|Ga0466694_231812_284_1150
Length
288 aa
Sequence
VNLILFETHELLKPLPRRDERTVHLLKVLHKKAGDTFEAGVLGGGRCSGKIEKIGIDGSLSFTIGIQSPSPPRLPVRVAVGFPRPIQVRRLLRDLSSLGVEAIDLFGTELGEKSYRDTKLLGGGGARSALIEGAAQSRDTTIPVLSIFTSLENWLQECPWENEGGAVSVPSLHTDTGSHRPPSAPSDRLTSSEWSSGQMELPPRRPAAVPLHIAADNVRPEGAISRMASTKRPVVLAIGSERGWSDRERDMFEEAGFLRLSLGSRALRTETACVAATVLAIEKIGELG

📊 Sample Types

Isolate 1.6%
Metagenome 98.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Kalotermitidae 26.5%
Rhinotermitidae 8.8%
Unclassified 8.8%
Termopsidae 5.9%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
31 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_014332 3300038395 Bacteria 6133
2 Ga0466691_175704 3300042593 Bacteria 16463
3 Ga0466699_000894 3300042597 Bacteria 31514
4 Ga0466720_082800 3300042607 Unclassified 1239
5 Ga0466712_009196 3300042614 Bacteria 1375
6 Ga0466712_261940 3300042614 Bacteria 11096
7 Ga0466702_285481 3300042635 Bacteria 1742
8 Ga0466709_198778 3300042648 Bacteria 15427
9 Ga0072941_1002176 3300005201 Bacteria 7975
10 Ga0466705_018878 3300042612 Bacteria 2038
11 Ga0466692_176759 3300042591 Bacteria 3071
12 Ga0466699_324577 3300042597 Bacteria 4740
13 Ga0466707_174292 3300042601 Bacteria 1472
14 Ga0466720_042491 3300042607 Bacteria 7915
15 Ga0466720_075638 3300042607 Bacteria 2658
16 Ga0466720_232819 3300042607 Bacteria 1732
17 Ga0123356_10088853 3300010049 Bacteria 2939
18 Ga0123353_11103015 3300010167 Bacteria 1053
19 JGI24698J34947_10008388 3300002449 Bacteria 5671
20 Ga0072940_1022666 3300005200 Bacteria 5242
21 Ga0466732_008940 3300042656 Bacteria 1827
22 Ga0466694_285787 3300042594 Bacteria 38692
23 Ga0466694_293843 3300042594 Bacteria 2388
24 Ga0466694_320736 3300042594 Bacteria 9120
25 Ga0466699_070973 3300042597 Bacteria 1481
26 Ga0466699_253489 3300042597 Bacteria 3915
27 Ga0466699_419086 3300042597 Bacteria 1756
28 Ga0466699_432121 3300042597 Bacteria 1180
29 Ga0466707_096479 3300042601 Bacteria 2299
30 Ga0466717_265347 3300042604 Bacteria 4146
31 Ga0123356_10316773 3300010049 Bacteria 1671
32 Ga0123354_10305537 3300010882 Bacteria 1496
33 Ga0466712_073534 3300042614 Bacteria 6292
34 Ga0466712_202943 3300042614 Bacteria 2112
35 Ga0466712_204006 3300042614 Bacteria 2739
36 Ga0466715_309971 3300042616 Bacteria 7071
37 Ga0466729_088903 3300042621 Bacteria 8390
38 JGI24698J34947_10000516 3300002449 Bacteria 18226
39 JGI24698J34947_10013200 3300002449 Bacteria 4514
40 JGI24698J34947_10025949 3300002449 Bacteria 3116
41 JGI24698J34947_10053923 3300002449 Bacteria 2010
42 JGI24698J34947_10080589 3300002449 Unclassified 1529
43 JGI24695J34938_10000290 3300002450 Unclassified 49669
44 JGI24695J34938_10007739 3300002450 Bacteria 6228
45 Ga0072940_1001818 3300005200 Bacteria 7055
46 Ga0466692_200957 3300042591 Bacteria 2755
47 Ga0466694_069940 3300042594 Bacteria 18221
48 Ga0466694_140737 3300042594 Bacteria 2037
49 Ga0466694_231812 3300042594 Bacteria 1374
50 Ga0466720_032894 3300042607 Bacteria 15096
51 Ga0466720_098651 3300042607 Bacteria 30361
52 Ga0466720_125042 3300042607 Bacteria 1451
53 Ga0466720_170729 3300042607 Bacteria 6409
54 Ga0123356_10104142 3300010049 Bacteria 2727
55 Ga0123353_10497279 3300010167 Bacteria 1778
56 Ga0123353_11268503 3300010167 Bacteria 960
57 Ga0123354_10136717 3300010882 Unclassified 3059
58 Ga0466712_048231 3300042614 Bacteria 21473
59 Ga0466712_167842 3300042614 Bacteria 4216
60 Ga0466711_340701 3300042615 Bacteria 2590
61 Ga0466726_243117 3300042619 Bacteria 14736
62 Ga0466702_378082 3300042635 Bacteria 3912
63 JGI24698J34947_10011535 3300002449 Bacteria 4852
64 Ga0466732_427349 3300042656 Bacteria 2817
65 Ga0415639_181075 3300038395 Bacteria 2875
66 Ga0466699_029835 3300042597 Bacteria 13973
67 Ga0466720_074271 3300042607 Bacteria 9576
68 Ga0466720_165120 3300042607 Bacteria 1350
69 Ga0123353_10106398 3300010167 Bacteria 4520
70 Ga0466712_189763 3300042614 Bacteria 10684
71 Ga0466718_152256 3300042617 Bacteria 1504
72 JGI24698J34947_10003957 3300002449 Bacteria 8058
73 JGI24698J34947_10004403 3300002449 Bacteria 7666
74 Ga0072941_1077465 3300005201 Bacteria 2787
75 Ga0072941_1137461 3300005201 Bacteria 4667
76 Ga0264413_114137 3300024493 Bacteria 16322
77 Ga0466692_081675 3300042591 Bacteria 1999
78 Ga0466720_031298 3300042607 Bacteria 12428
79 Ga0466720_157358 3300042607 Bacteria 5370
80 Ga0466720_218533 3300042607 Bacteria 7675
81 Ga0466720_228424 3300042607 Bacteria 12236
82 Ga0123353_10185084 3300010167 Unclassified 3294
83 Ga0466712_038950 3300042614 Bacteria 1714
84 Ga0466711_066856 3300042615 Bacteria 1712
85 Ga0466702_409959 3300042635 Bacteria 1302
86 Ga0466703_341938 3300042636 Unclassified 7047
87 Ga0466727_102424 3300042655 Bacteria 6018
88 Ga0466727_167989 3300042655 Bacteria 2948
89 Ga0072941_1013284 3300005201 Bacteria 4595
90 Ga0466690_118429 3300042590 Bacteria 1518
91 Ga0466692_101102 3300042591 Bacteria 6344
92 Ga0466692_182973 3300042591 Bacteria 1818
93 Ga0466700_439687 3300042600 Bacteria 1127
94 Ga0466720_092177 3300042607 Bacteria 42147
95 Ga0466720_125366 3300042607 Bacteria 14214
96 Ga0466722_012945 3300042609 Bacteria 10242
97 Ga0466722_185308 3300042609 Bacteria 17287
98 Ga0466722_264027 3300042609 Bacteria 1484
99 Ga0466698_466528 3300042610 Bacteria 9053
100 Ga0123356_10069036 3300010049 Bacteria 3313
101 Ga0466712_032180 3300042614 Bacteria 7476
102 Ga0466712_125211 3300042614 Bacteria 1568
103 Ga0466712_136961 3300042614 Bacteria 7783
104 Ga0466712_264634 3300042614 Bacteria 1299
105 Ga0466718_037199 3300042617 Bacteria 3163
106 JGI24698J34947_10053985 3300002449 Bacteria 2009
107 Ga0466705_082328 3300042612 Bacteria 3829
108 Ga0264413_119857 3300024493 Bacteria 7085
109 Ga0466692_062847 3300042591 Bacteria 4421
110 Ga0466694_027240 3300042594 Bacteria 14900
111 Ga0466694_165381 3300042594 Bacteria 1395
112 Ga0466694_409225 3300042594 Bacteria 36264
113 Ga0466716_271802 3300042605 Bacteria 8204
114 Ga0466720_178854 3300042607 Unclassified 5619
115 Ga0466720_192734 3300042607 Bacteria 2660
116 Ga0466712_058450 3300042614 Bacteria 7817
117 Ga0466712_274014 3300042614 Bacteria 1216
118 Ga0466726_146371 3300042619 Bacteria 1240
119 Ga0466704_414876 3300042643 Bacteria 5328
120 JGI24698J34947_10009564 3300002449 Bacteria 5319
121 JGI24695J34938_10045736 3300002450 Bacteria 1940
122 Ga0072941_1004316 3300005201 Bacteria 33459
123 Ga0072941_1012642 3300005201 Bacteria 9566

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_009196 Ga0466712_009196_223_960 232
2 3300042614 Ga0466712_167842 Ga0466712_167842_941_1681 232
3 3300042614 Ga0466712_204006 Ga0466712_204006_662_1399 232
4 3300002449 JGI24698J34947_10003957 JGI24698J34947_100039573 233
5 3300002449 JGI24698J34947_10004403 JGI24698J34947_100044033 233
6 3300042607 Ga0466720_082800 Ga0466720_082800_23_772 234
7 3300005201 Ga0072941_1002176 Ga0072941_10021767 236
8 3300002449 JGI24698J34947_10025949 JGI24698J34947_100259492 237
9 3300042601 Ga0466707_174292 Ga0466707_174292_347_1108 237
10 3300042607 Ga0466720_165120 Ga0466720_165120_23_772 237
11 3300042635 Ga0466702_378082 Ga0466702_378082_2464_3183 239
12 3300002450 JGI24695J34938_10000290 JGI24695J34938_1000029016 240
13 3300042590 Ga0466690_118429 Ga0466690_118429_733_1503 241
14 3300042607 Ga0466720_098651 Ga0466720_098651_3028_3804 242
15 3300042616 Ga0466715_309971 Ga0466715_309971_4465_5193 242
16 3300042607 Ga0466720_218533 Ga0466720_218533_178_939 243
17 3300010049 Ga0123356_10069036 Ga0123356_100690363 244
18 3300042597 Ga0466699_419086 Ga0466699_419086_645_1379 244
19 3300042597 Ga0466699_432121 Ga0466699_432121_211_945 244
20 3300042635 Ga0466702_285481 Ga0466702_285481_496_1230 244
21 3300005201 Ga0072941_1137461 Ga0072941_11374613 245
22 3300042594 Ga0466694_140737 Ga0466694_140737_979_1716 245
23 3300042594 Ga0466694_320736 Ga0466694_320736_4954_5691 245
24 3300042614 Ga0466712_136961 Ga0466712_136961_557_1294 245
25 3300042635 Ga0466702_409959 Ga0466702_409959_179_916 245
26 3300042594 Ga0466694_027240 Ga0466694_027240_8883_9623 246
27 3300042597 Ga0466699_000894 Ga0466699_000894_27117_27857 246
28 3300042597 Ga0466699_029835 Ga0466699_029835_3517_4257 246
29 3300042597 Ga0466699_253489 Ga0466699_253489_389_1129 246
30 3300002449 JGI24698J34947_10009564 JGI24698J34947_100095642 247
31 3300010049 Ga0123356_10104142 Ga0123356_101041423 247
32 3300024493 Ga0264413_114137 Ga0264413_11413718 247
33 3300024493 Ga0264413_119857 Ga0264413_1198572 247
34 3300042594 Ga0466694_285787 Ga0466694_285787_28087_28830 247
35 3300042607 Ga0466720_032894 Ga0466720_032894_7181_7924 247
36 3300042607 Ga0466720_042491 Ga0466720_042491_2705_3448 247
37 3300042607 Ga0466720_074271 Ga0466720_074271_8315_9058 247
38 3300042614 Ga0466712_125211 Ga0466712_125211_501_1244 247
39 3300042621 Ga0466729_088903 Ga0466729_088903_5824_6567 247
40 3300042656 Ga0466732_008940 Ga0466732_008940_387_1130 247
41 3300002449 JGI24698J34947_10011535 JGI24698J34947_100115352 248
42 3300002449 JGI24698J34947_10013200 JGI24698J34947_100132003 248
43 3300038395 Ga0415639_181075 Ga0415639_181075_1651_2397 248
44 3300042594 Ga0466694_409225 Ga0466694_409225_24336_25082 248
45 3300042600 Ga0466700_439687 Ga0466700_439687_31_777 248
46 3300042609 Ga0466722_012945 Ga0466722_012945_8148_8894 248
47 3300042609 Ga0466722_264027 Ga0466722_264027_582_1328 248
48 3300042614 Ga0466712_032180 Ga0466712_032180_1587_2333 248
49 3300042614 Ga0466712_264634 Ga0466712_264634_275_1021 248
50 3300002449 JGI24698J34947_10008388 JGI24698J34947_100083883 249
51 3300002449 JGI24698J34947_10053923 JGI24698J34947_100539233 249
52 3300002449 JGI24698J34947_10080589 JGI24698J34947_100805892 249
53 3300005201 Ga0072941_1004316 Ga0072941_100431639 249
54 3300005201 Ga0072941_1013284 Ga0072941_10132843 249
55 3300005201 Ga0072941_1077465 Ga0072941_10774652 249
56 3300010167 Ga0123353_10185084 Ga0123353_101850842 249
57 3300042591 Ga0466692_081675 Ga0466692_081675_1001_1750 249
58 3300042591 Ga0466692_176759 Ga0466692_176759_2047_2796 249
59 3300042597 Ga0466699_324577 Ga0466699_324577_3265_4014 249
60 3300042607 Ga0466720_125042 Ga0466720_125042_227_976 249
61 3300042617 Ga0466718_037199 Ga0466718_037199_161_910 249
62 3300005200 Ga0072940_1022666 Ga0072940_10226663 250
63 3300042597 Ga0466699_070973 Ga0466699_070973_280_1032 250
64 3300042593 Ga0466691_175704 Ga0466691_175704_5534_6289 251
65 3300042605 Ga0466716_271802 Ga0466716_271802_7334_8089 251
66 3300042619 Ga0466726_146371 Ga0466726_146371_179_934 251
67 3300002450 JGI24695J34938_10045736 JGI24695J34938_100457362 252
68 3300010049 Ga0123356_10088853 Ga0123356_100888533 252
69 3300042607 Ga0466720_170729 Ga0466720_170729_227_985 252
70 3300042656 Ga0466732_427349 Ga0466732_427349_1459_2217 252
71 3300005200 Ga0072940_1001818 Ga0072940_10018186 253
72 3300005201 Ga0072941_1012642 Ga0072941_10126427 253
73 3300042614 Ga0466712_048231 Ga0466712_048231_15808_16569 253
74 3300042614 Ga0466712_261940 Ga0466712_261940_4332_5093 253
75 3300042614 Ga0466712_274014 Ga0466712_274014_98_859 253
76 3300042648 Ga0466709_198778 Ga0466709_198778_11835_12599 254
77 iso_pr_bacteria 2781125656 2781320355 254
78 3300002449 JGI24698J34947_10053985 JGI24698J34947_100539852 255
79 3300042607 Ga0466720_092177 Ga0466720_092177_40765_41532 255
80 iso_pr_bacteria 2781125645 2781298733 255
81 3300042601 Ga0466707_096479 Ga0466707_096479_362_1135 257
82 3300042655 Ga0466727_167989 Ga0466727_167989_228_1001 257
83 3300010167 Ga0123353_10497279 Ga0123353_104972792 258
84 3300042591 Ga0466692_101102 Ga0466692_101102_2266_3042 258
85 3300042607 Ga0466720_178854 Ga0466720_178854_2653_3429 258
86 3300042655 Ga0466727_102424 Ga0466727_102424_648_1424 258
87 3300042607 Ga0466720_125366 Ga0466720_125366_9879_10658 259
88 3300042591 Ga0466692_182973 Ga0466692_182973_788_1570 260
89 3300042607 Ga0466720_031298 Ga0466720_031298_1230_2012 260
90 3300042607 Ga0466720_157358 Ga0466720_157358_1731_2513 260
91 3300042607 Ga0466720_192734 Ga0466720_192734_433_1215 260
92 3300042607 Ga0466720_232819 Ga0466720_232819_52_834 260
93 3300042617 Ga0466718_152256 Ga0466718_152256_355_1137 260
94 3300002450 JGI24695J34938_10007739 JGI24695J34938_100077393 261
95 3300042594 Ga0466694_293843 Ga0466694_293843_556_1341 261
96 3300042607 Ga0466720_075638 Ga0466720_075638_1157_1945 262
97 3300042607 Ga0466720_228424 Ga0466720_228424_10374_11162 262
98 3300042614 Ga0466712_038950 Ga0466712_038950_26_814 262
99 3300042615 Ga0466711_066856 Ga0466711_066856_552_1340 262
100 3300042615 Ga0466711_340701 Ga0466711_340701_1513_2301 262
101 3300042591 Ga0466692_062847 Ga0466692_062847_2386_3177 263
102 3300042609 Ga0466722_185308 Ga0466722_185308_5599_6390 263
103 3300042643 Ga0466704_414876 Ga0466704_414876_4028_4819 263
104 3300010167 Ga0123353_11268503 Ga0123353_112685032 264
105 3300042636 Ga0466703_341938 Ga0466703_341938_2934_3740 268
106 3300042614 Ga0466712_073534 Ga0466712_073534_1544_2353 269
107 3300042614 Ga0466712_189763 Ga0466712_189763_1586_2395 269
108 3300042614 Ga0466712_202943 Ga0466712_202943_1163_1972 269
109 3300002449 JGI24698J34947_10000516 JGI24698J34947_1000051610 270
110 3300010167 Ga0123353_10106398 Ga0123353_101063983 270
111 3300010882 Ga0123354_10136717 Ga0123354_101367173 270
112 3300038395 Ga0415639_014332 Ga0415639_014332_890_1702 270
113 3300042604 Ga0466717_265347 Ga0466717_265347_305_1123 272
114 3300042614 Ga0466712_058450 Ga0466712_058450_4426_5247 273
115 3300042612 Ga0466705_082328 Ga0466705_082328_1003_1827 274
116 3300042612 Ga0466705_018878 Ga0466705_018878_741_1571 276
117 3300042594 Ga0466694_165381 Ga0466694_165381_115_966 283
118 3300010167 Ga0123353_11103015 Ga0123353_111030151 284
119 3300042591 Ga0466692_200957 Ga0466692_200957_375_1229 284
120 3300042594 Ga0466694_069940 Ga0466694_069940_17298_18155 285
121 3300042610 Ga0466698_466528 Ga0466698_466528_2091_2951 286
122 3300042594 Ga0466694_231812 Ga0466694_231812_284_1150 288
123 3300010882 Ga0123354_10305537 Ga0123354_103055371 292
124 3300042619 Ga0466726_243117 Ga0466726_243117_13085_14017 310
125 3300010049 Ga0123356_10316773 Ga0123356_103167732 312

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04452 Methyltrans_RNA RNA methyltransferase domain 73 158 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.