Protein Family IF05010

Metagenome Metatranscriptome Isolate
187 Members
58 Samples
173 Scaffolds
390.73 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_196685|Ga0466694_196685_1933_3300
Length
455 aa
Sequence
MKKSADNVCYVSLFAPIAVYRSLRANETTLTSIIVRVAGFARKFVLSAPYPCHPPMKFEMEETMSKRDRLSGNEAVANAIRQIGPDVIAAFPITPSTEIPQFISSFKADGLLDSEFVAVESEHSAMAACIGATSAGVRSLTATSSAGMALMYELLYVAASDRLPIVVAAVNRALTGPINIQADHSDSMGARDSGWIQIYSENAQEAYDNMLMAYRIAEHPDVRLPVMICQDGFITSHSVENIVIEDDKLVKDFVGEYQPDKYLLNPSESLSIGPYSIFAYYMEFKRQQFESMRNALKVIKDVSEEYGKLTGRNYGMLEKYRMDDAELGLLLMSSAAGTGKAAVDGLREKGIKAGLVKLRSFRPFPDEEIADALKDLKALGIMDRSDIFSGCGGPLGAEVRGALYGRVEGLRNINYVYGLGGRDIQVADFVAIFDELGRLAAGEEVPRCRYQGVRE

📊 Sample Types

Isolate 7.5%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.8%
Unclassified 26.3%
Kalotermitidae 24.6%
Rhinotermitidae 5.3%
Termopsidae 3.5%
Hodotermitidae 1.8%
Passalidae 1.8%

🌳 Taxonomy

Archaea 7
Bacteria 171
Eukaryota 0
Viruses 1
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
2 2772190993 Unclassified Euryarchaeota Lab288P4bin101 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
14 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
15 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
16 2820406809 Unclassified Firmicutes Lab288P4bin87 Isolate Unclassified
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
25 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
34 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
43 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
44 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
45 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
48 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
49 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
50 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
51 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
52 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
53 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
54 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
55 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
56 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
57 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
58 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_196541 3300042656 Bacteria 122148
2 Ga0466707_133081 3300042601 Bacteria 26278
3 Ga0466707_276736 3300042601 Bacteria 11408
4 Ga0466707_383777 3300042601 Bacteria 2758
5 Ga0466713_059769 3300042602 Bacteria 172763
6 Ga0466713_151171 3300042602 Bacteria 17884
7 JGI24700J35501_10930335 3300002508 Bacteria 13112
8 Ga0233288_1009015 3300022232 Bacteria 2874
9 Ga0466693_046107 3300042592 Archaea 2099
10 Ga0466696_461950 3300042596 Archaea 3881
11 Ga0466734_145803 3300042623 Bacteria 2221
12 Ga0466703_177121 3300042636 Bacteria 2639
13 Ga0466727_297031 3300042655 Bacteria 16177
14 Ga0123355_10000708 3300009826 Bacteria 45250
15 Ga0123355_10021872 3300009826 Bacteria 10246
16 Ga0123355_10039120 3300009826 Bacteria 7714
17 Ga0123355_10061690 3300009826 Bacteria 6052
18 Ga0123355_10090641 3300009826 Bacteria 4849
19 Ga0123355_10125259 3300009826 Bacteria 3972
20 Ga0123355_10483426 3300009826 Bacteria 1539
21 Ga0123353_10025445 3300010167 Bacteria 9019
22 Ga0466723_023324 3300042618 Bacteria 7109
23 Ga0466723_196764 3300042618 Bacteria 4781
24 Ga0466705_035944 3300042612 Bacteria 2275
25 Ga0466705_070622 3300042612 Bacteria 7514
26 Ga0466714_065131 3300042603 Bacteria 171349
27 Ga0466722_158555 3300042609 Bacteria 3949
28 Ga0105524_105363 3300007733 Bacteria 2852
29 Ga0466692_096767 3300042591 Bacteria 2443
30 Ga0466694_196685 3300042594 Bacteria 3474
31 Ga0466704_074060 3300042643 Bacteria 20452
32 Ga0123355_10000236 3300009826 Bacteria 70725
33 Ga0123355_10009611 3300009826 Bacteria 14736
34 Ga0123355_10114932 3300009826 Bacteria 4194
35 Ga0123355_10319840 3300009826 Bacteria 2092
36 Ga0123356_10039010 3300010049 Bacteria 4425
37 Ga0123356_10104271 3300010049 Bacteria 2726
38 Ga0123354_10015872 3300010882 Bacteria 11787
39 Ga0466711_435615 3300042615 Bacteria 6976
40 Ga0466726_072525 3300042619 Bacteria 10313
41 Ga0466729_155428 3300042621 Bacteria 41381
42 Ga0466705_163322 3300042612 Bacteria 155241
43 Ga0466707_207148 3300042601 Bacteria 55703
44 Ga0466707_289569 3300042601 Bacteria 7562
45 Ga0466722_140838 3300042609 Bacteria 2372
46 Ga0466692_121745 3300042591 Bacteria 37508
47 Ga0466692_192911 3300042591 Unclassified 1515
48 Ga0466694_014319 3300042594 Bacteria 5964
49 Ga0466734_077313 3300042623 Archaea 13094
50 Ga0466704_217687 3300042643 Bacteria 53708
51 Ga0466725_281694 3300042654 Bacteria 6492
52 Ga0123357_10083249 3300009784 Bacteria 4199
53 Ga0123355_10000007 3300009826 Bacteria 193006
54 Ga0123355_10247217 3300009826 Bacteria 2517
55 Ga0123355_10288015 3300009826 Bacteria 2258
56 Ga0123356_10011491 3300010049 Bacteria 8628
57 Ga0123356_10083123 3300010049 Bacteria 3033
58 Ga0466715_094489 3300042616 Bacteria 25727
59 Ga0466718_075105 3300042617 Bacteria 2171
60 Ga0466723_172322 3300042618 Bacteria 7972
61 Ga0466728_121192 3300042620 Bacteria 7258
62 Ga0466706_108854 3300042599 Bacteria 3750
63 Ga0466707_026018 3300042601 Unclassified 2446
64 Ga0466707_079270 3300042601 Bacteria 9664
65 Ga0466707_123662 3300042601 Bacteria 22376
66 Ga0466707_302119 3300042601 Archaea 3202
67 Ga0466707_344188 3300042601 Bacteria 1857
68 Ga0466696_113064 3300042596 Bacteria 15775
69 Ga0466696_412818 3300042596 Bacteria 6145
70 Ga0466703_038750 3300042636 Bacteria 2712
71 Ga0466703_289148 3300042636 Bacteria 257603
72 Ga0466704_155886 3300042643 Bacteria 3738
73 Ga0123355_10000137 3300009826 Bacteria 86760
74 Ga0123355_10000425 3300009826 Bacteria 55188
75 Ga0123355_10000798 3300009826 Bacteria 43111
76 Ga0123355_10001474 3300009826 Bacteria 32752
77 Ga0123355_10173634 3300009826 Bacteria 3215
78 Ga0123355_10246847 3300009826 Bacteria 2520
79 Ga0123355_10267051 3300009826 Bacteria 2384
80 Ga0123355_10314245 3300009826 Viruses 2119
81 Ga0123354_10100825 3300010882 Archaea 3905
82 Ga0466710_316081 3300042613 Archaea 3086
83 Ga0466711_063294 3300042615 Bacteria 3340
84 Ga0466711_245138 3300042615 Unclassified 5632
85 Ga0466715_236347 3300042616 Bacteria 15758
86 Ga0466726_108283 3300042619 Bacteria 13947
87 Ga0466728_017755 3300042620 Bacteria 55878
88 Ga0466705_273889 3300042612 Bacteria 1946
89 Ga0466706_179574 3300042599 Bacteria 7020
90 Ga0466707_057550 3300042601 Bacteria 2313
91 Ga0466716_002369 3300042605 Bacteria 11317
92 JGI24695J34938_10046713 3300002450 Bacteria 1916
93 Ga0466690_071587 3300042590 Bacteria 5658
94 Ga0466691_088322 3300042593 Bacteria 2510
95 Ga0466696_220553 3300042596 Bacteria 5229
96 Ga0466703_175253 3300042636 Bacteria 8925
97 Ga0123355_10000163 3300009826 Bacteria 81520
98 Ga0123355_10002139 3300009826 Bacteria 27898
99 Ga0123355_10311506 3300009826 Bacteria 2133
100 Ga0123355_10315696 3300009826 Bacteria 2112
101 Ga0123356_10007504 3300010049 Unclassified 10875
102 Ga0466705_110615 3300042612 Bacteria 9331
103 Ga0466705_249606 3300042612 Bacteria 3495
104 Ga0466706_156785 3300042599 Bacteria 7397
105 Ga0466707_329239 3300042601 Bacteria 2769
106 Ga0466707_350983 3300042601 Bacteria 18008
107 Ga0466713_089138 3300042602 Bacteria 1980
108 Ga0466717_251192 3300042604 Bacteria 1551
109 Ga0466719_067204 3300042606 Bacteria 6261
110 Ga0466719_152038 3300042606 Bacteria 2921
111 Ga0415639_019488 3300038395 Bacteria 2476
112 Ga0466691_032116 3300042593 Bacteria 33249
113 Ga0466696_036667 3300042596 Bacteria 22217
114 Ga0466703_191444 3300042636 Bacteria 3722
115 Ga0466704_102161 3300042643 Unclassified 4835
116 Ga0466704_223321 3300042643 Bacteria 20344
117 Ga0466724_40609 3300042649 Bacteria 2009
118 Ga0466708_000584 3300042652 Bacteria 5303
119 Ga0466708_229616 3300042652 Bacteria 8864
120 Ga0466708_270559 3300042652 Bacteria 3234
121 Ga0466727_029142 3300042655 Bacteria 9896
122 Ga0123355_10002608 3300009826 Bacteria 25579
123 Ga0123355_10027676 3300009826 Bacteria 9158
124 Ga0123355_10083182 3300009826 Bacteria 5103
125 Ga0123355_10099222 3300009826 Bacteria 4590
126 Ga0123356_10005529 3300010049 Bacteria 12857
127 Ga0123353_10192335 3300010167 Bacteria 3219
128 Ga0466726_374993 3300042619 Bacteria 9560
129 Ga0466705_285885 3300042612 Bacteria 1687
130 Ga0466706_288143 3300042599 Bacteria 1726
131 Ga0466707_136448 3300042601 Bacteria 7744
132 Ga0466719_383538 3300042606 Unclassified 1327
133 Ga0466722_257319 3300042609 Bacteria 3878
134 IMNBL1DRAFT_c0000422 3300000062 Bacteria 35538
135 Ga0466694_174371 3300042594 Bacteria 3600
136 Ga0466729_316237 3300042621 Bacteria 22092
137 Ga0466703_302096 3300042636 Unclassified 2998
138 Ga0466704_160092 3300042643 Bacteria 2295
139 Ga0466709_261935 3300042648 Bacteria 22275
140 Ga0466727_060522 3300042655 Bacteria 5157
141 Ga0123355_10281012 3300009826 Unclassified 2298
142 Ga0123353_10311966 3300010167 Bacteria 2393
143 Ga0466715_409955 3300042616 Bacteria 3452
144 Ga0466723_112190 3300042618 Bacteria 3478
145 Ga0466726_176348 3300042619 Bacteria 2677
146 Ga0466726_196871 3300042619 Bacteria 1375
147 Ga0466705_110916 3300042612 Bacteria 65673
148 Ga0466705_282032 3300042612 Bacteria 2033
149 Ga0466732_112578 3300042656 Bacteria 16046
150 Ga0466706_033081 3300042599 Bacteria 1828
151 Ga0466700_067571 3300042600 Bacteria 2225
152 Ga0466707_128362 3300042601 Bacteria 27013
153 Ga0466707_141553 3300042601 Bacteria 8298
154 Ga0466722_015515 3300042609 Bacteria 8002
155 IMNBL1DRAFT_c0001007 3300000062 Bacteria 21724
156 Ga0415639_000285 3300038395 Bacteria 3228
157 Ga0466692_167471 3300042591 Bacteria 24626
158 Ga0466694_017302 3300042594 Bacteria 1858
159 Ga0466696_163379 3300042596 Bacteria 3549
160 Ga0466703_065686 3300042636 Bacteria 26926
161 Ga0466704_010688 3300042643 Bacteria 3414
162 Ga0123355_10000169 3300009826 Bacteria 79359
163 Ga0123355_10000712 3300009826 Bacteria 45162
164 Ga0123355_10036309 3300009826 Bacteria 8012
165 Ga0123355_10229563 3300009826 Bacteria 2653
166 Ga0123355_10299621 3300009826 Bacteria 2194
167 Ga0123356_10108442 3300010049 Bacteria 2677
168 Ga0123353_10022023 3300010167 Bacteria 9589
169 Ga0123353_10061004 3300010167 Bacteria 6047
170 Ga0123353_10164659 3300010167 Bacteria 3526
171 Ga0123353_10170373 3300010167 Bacteria 3457
172 Ga0123353_10209427 3300010167 Bacteria 3059
173 Ga0466726_013094 3300042619 Bacteria 1598

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_133081 Ga0466707_133081_9261_10469 349
2 3300042643 Ga0466704_010688 Ga0466704_010688_781_1938 364
3 3300009826 Ga0123355_10021872 Ga0123355_1002187213 365
4 3300042601 Ga0466707_302119 Ga0466707_302119_1130_2326 365
5 3300042619 Ga0466726_072525 Ga0466726_072525_8072_9238 366
6 3300042612 Ga0466705_282032 Ga0466705_282032_218_1375 368
7 3300009826 Ga0123355_10000137 Ga0123355_1000013725 369
8 3300009826 Ga0123355_10002139 Ga0123355_1000213922 370
9 3300009826 Ga0123355_10039120 Ga0123355_1003912011 372
10 3300010167 Ga0123353_10025445 Ga0123353_100254452 372
11 3300042601 Ga0466707_079270 Ga0466707_079270_1953_3122 373
12 3300042601 Ga0466707_289569 Ga0466707_289569_2295_3464 373
13 3300009826 Ga0123355_10173634 Ga0123355_101736343 374
14 3300009826 Ga0123355_10229563 Ga0123355_102295631 374
15 3300042636 Ga0466703_038750 Ga0466703_038750_1051_2226 374
16 3300009826 Ga0123355_10099222 Ga0123355_100992224 376
17 3300042612 Ga0466705_285885 Ga0466705_285885_210_1388 377
18 3300042596 Ga0466696_113064 Ga0466696_113064_14460_15638 379
19 3300042601 Ga0466707_057550 Ga0466707_057550_439_1626 379
20 3300009826 Ga0123355_10000708 Ga0123355_1000070839 380
21 3300042617 Ga0466718_075105 Ga0466718_075105_66_1208 380
22 3300009826 Ga0123355_10311506 Ga0123355_103115062 381
23 3300042604 Ga0466717_251192 Ga0466717_251192_149_1294 381
24 3300009826 Ga0123355_10000007 Ga0123355_10000007137 382
25 3300009826 Ga0123355_10000425 Ga0123355_1000042511 384
26 3300010167 Ga0123353_10209427 Ga0123353_102094272 384
27 3300042601 Ga0466707_128362 Ga0466707_128362_24343_25497 384
28 3300042602 Ga0466713_151171 Ga0466713_151171_5352_6506 384
29 3300009826 Ga0123355_10083182 Ga0123355_100831826 385
30 3300042591 Ga0466692_096767 Ga0466692_096767_352_1509 385
31 3300042591 Ga0466692_167471 Ga0466692_167471_499_1656 385
32 3300042601 Ga0466707_026018 Ga0466707_026018_681_1838 385
33 3300042601 Ga0466707_141553 Ga0466707_141553_3101_4306 385
34 3300042602 Ga0466713_089138 Ga0466713_089138_122_1279 385
35 3300042612 Ga0466705_070622 Ga0466705_070622_1053_2210 385
36 3300042612 Ga0466705_273889 Ga0466705_273889_405_1562 385
37 3300042621 Ga0466729_155428 Ga0466729_155428_1306_2511 385
38 3300042636 Ga0466703_302096 Ga0466703_302096_508_1665 385
39 3300042643 Ga0466704_160092 Ga0466704_160092_50_1207 385
40 3300042652 Ga0466708_000584 Ga0466708_000584_2063_3220 385
41 3300042655 Ga0466727_029142 Ga0466727_029142_6480_7637 385
42 3300042655 Ga0466727_060522 Ga0466727_060522_2533_3690 385
43 3300009826 Ga0123355_10000712 Ga0123355_1000071214 386
44 3300009826 Ga0123355_10319840 Ga0123355_103198402 386
45 3300042591 Ga0466692_121745 Ga0466692_121745_26784_27944 386
46 3300042596 Ga0466696_412818 Ga0466696_412818_1876_3036 386
47 3300042612 Ga0466705_249606 Ga0466705_249606_2084_3244 386
48 3300042615 Ga0466711_435615 Ga0466711_435615_2095_3255 386
49 3300009826 Ga0123355_10314245 Ga0123355_103142452 387
50 3300010167 Ga0123353_10061004 Ga0123353_100610048 387
51 3300042601 Ga0466707_344188 Ga0466707_344188_280_1443 387
52 3300042599 Ga0466706_033081 Ga0466706_033081_544_1710 388
53 3300042609 Ga0466722_158555 Ga0466722_158555_471_1637 388
54 3300042619 Ga0466726_196871 Ga0466726_196871_163_1329 388
55 3300042621 Ga0466729_316237 Ga0466729_316237_16762_17928 388
56 3300009784 Ga0123357_10083249 Ga0123357_100832492 389
57 3300009826 Ga0123355_10061690 Ga0123355_100616902 389
58 3300010049 Ga0123356_10007504 Ga0123356_1000750412 389
59 3300010167 Ga0123353_10170373 Ga0123353_101703732 389
60 3300010167 Ga0123353_10311966 Ga0123353_103119663 389
61 3300042601 Ga0466707_383777 Ga0466707_383777_527_1696 389
62 3300042636 Ga0466703_175253 Ga0466703_175253_1316_2485 389
63 3300009826 Ga0123355_10000798 Ga0123355_100007982 390
64 3300042591 Ga0466692_192911 Ga0466692_192911_57_1229 390
65 3300042592 Ga0466693_046107 Ga0466693_046107_447_1619 390
66 3300042601 Ga0466707_136448 Ga0466707_136448_3977_5149 390
67 3300042601 Ga0466707_276736 Ga0466707_276736_1309_2481 390
68 3300042613 Ga0466710_316081 Ga0466710_316081_1625_2797 390
69 3300042616 Ga0466715_236347 Ga0466715_236347_1170_2342 390
70 3300042623 Ga0466734_077313 Ga0466734_077313_3730_4902 390
71 iso_pu_archaea 2772190993 2773786521 390
72 3300010049 Ga0123356_10083123 Ga0123356_100831232 391
73 3300010882 Ga0123354_10100825 Ga0123354_101008253 391
74 3300042601 Ga0466707_329239 Ga0466707_329239_869_2044 391
75 3300042606 Ga0466719_383538 Ga0466719_383538_93_1268 391
76 3300042609 Ga0466722_015515 Ga0466722_015515_400_1575 391
77 3300042616 Ga0466715_409955 Ga0466715_409955_1625_2800 391
78 3300042619 Ga0466726_013094 Ga0466726_013094_28_1203 391
79 3300042643 Ga0466704_102161 Ga0466704_102161_38_1213 391
80 3300042643 Ga0466704_223321 Ga0466704_223321_7009_8184 391
81 3300010049 Ga0123356_10108442 Ga0123356_101084422 392
82 3300010167 Ga0123353_10022023 Ga0123353_100220235 392
83 3300042593 Ga0466691_088322 Ga0466691_088322_1190_2368 392
84 3300042596 Ga0466696_036667 Ga0466696_036667_1631_2809 392
85 3300042596 Ga0466696_461950 Ga0466696_461950_2280_3458 392
86 3300042605 Ga0466716_002369 Ga0466716_002369_3600_4778 392
87 3300042606 Ga0466719_152038 Ga0466719_152038_275_1453 392
88 3300042609 Ga0466722_140838 Ga0466722_140838_408_1586 392
89 3300042609 Ga0466722_257319 Ga0466722_257319_1878_3056 392
90 3300042612 Ga0466705_110615 Ga0466705_110615_7698_8876 392
91 3300042612 Ga0466705_110916 Ga0466705_110916_11622_12800 392
92 3300042616 Ga0466715_094489 Ga0466715_094489_13841_15019 392
93 3300042618 Ga0466723_023324 Ga0466723_023324_3333_4511 392
94 3300042618 Ga0466723_172322 Ga0466723_172322_3076_4254 392
95 3300042618 Ga0466723_196764 Ga0466723_196764_1694_2872 392
96 3300042620 Ga0466728_121192 Ga0466728_121192_4190_5368 392
97 3300042643 Ga0466704_074060 Ga0466704_074060_10636_11814 392
98 3300042649 Ga0466724_40609 Ga0466724_40609_574_1752 392
99 3300042652 Ga0466708_229616 Ga0466708_229616_4256_5434 392
100 iso_pr_bacteria 2820613375 2820613766 392
101 iso_pr_bacteria 2820666966 2820668956 392
102 3300000062 IMNBL1DRAFT_c0001007 IMNBL1DRAFT_000100710 393
103 3300009826 Ga0123355_10000163 Ga0123355_1000016367 393
104 3300042594 Ga0466694_014319 Ga0466694_014319_2749_3930 393
105 3300042594 Ga0466694_174371 Ga0466694_174371_1616_2797 393
106 3300042596 Ga0466696_163379 Ga0466696_163379_2166_3347 393
107 3300042601 Ga0466707_350983 Ga0466707_350983_64_1245 393
108 3300042612 Ga0466705_035944 Ga0466705_035944_503_1684 393
109 3300042615 Ga0466711_063294 Ga0466711_063294_845_2026 393
110 3300042619 Ga0466726_374993 Ga0466726_374993_5083_6264 393
111 3300042620 Ga0466728_017755 Ga0466728_017755_35701_36882 393
112 3300042623 Ga0466734_145803 Ga0466734_145803_254_1435 393
113 3300042636 Ga0466703_289148 Ga0466703_289148_206171_207352 393
114 3300042643 Ga0466704_155886 Ga0466704_155886_1294_2475 393
115 3300042655 Ga0466727_297031 Ga0466727_297031_3963_5144 393
116 iso_pr_bacteria 2819994798 2819996543 393
117 iso_pr_bacteria 2820501819 2820504135 393
118 iso_pr_bacteria 2820539610 2820540746 393
119 3300002508 JGI24700J35501_10930335 JGI24700J35501_109303356 394
120 3300009826 Ga0123355_10125259 Ga0123355_101252593 394
121 3300010049 Ga0123356_10104271 Ga0123356_101042714 394
122 3300010167 Ga0123353_10164659 Ga0123353_101646591 394
123 3300022232 Ga0233288_1009015 Ga0233288_10090153 394
124 3300038395 Ga0415639_000285 Ga0415639_000285_229_1413 394
125 3300042594 Ga0466694_017302 Ga0466694_017302_520_1704 394
126 3300042602 Ga0466713_059769 Ga0466713_059769_117035_118219 394
127 3300042618 Ga0466723_112190 Ga0466723_112190_860_2044 394
128 3300042654 Ga0466725_281694 Ga0466725_281694_1764_2948 394
129 iso_pr_bacteria 2529293168 2531452639 394
130 iso_pr_bacteria 2820285501 2820288355 394
131 iso_pr_bacteria 2820479655 2820480315 394
132 iso_pr_bacteria 2820615445 2820616589 394
133 iso_pr_bacteria 2820617402 2820617538 394
134 iso_pr_bacteria 2820693137 2820695815 394
135 3300002450 JGI24695J34938_10046713 JGI24695J34938_100467132 395
136 3300009826 Ga0123355_10000236 Ga0123355_1000023645 395
137 3300009826 Ga0123355_10001474 Ga0123355_100014742 395
138 3300009826 Ga0123355_10002608 Ga0123355_1000260829 395
139 3300009826 Ga0123355_10009611 Ga0123355_1000961113 395
140 3300009826 Ga0123355_10027676 Ga0123355_100276768 395
141 3300009826 Ga0123355_10090641 Ga0123355_100906415 395
142 3300009826 Ga0123355_10114932 Ga0123355_101149323 395
143 3300009826 Ga0123355_10246847 Ga0123355_102468475 395
144 3300009826 Ga0123355_10247217 Ga0123355_102472172 395
145 3300009826 Ga0123355_10267051 Ga0123355_102670512 395
146 3300009826 Ga0123355_10281012 Ga0123355_102810122 395
147 3300009826 Ga0123355_10288015 Ga0123355_102880152 395
148 3300009826 Ga0123355_10299621 Ga0123355_102996212 395
149 3300009826 Ga0123355_10483426 Ga0123355_104834262 395
150 3300010049 Ga0123356_10005529 Ga0123356_100055296 395
151 3300010049 Ga0123356_10011491 Ga0123356_100114912 395
152 3300010049 Ga0123356_10039010 Ga0123356_100390106 395
153 3300010167 Ga0123353_10192335 Ga0123353_101923351 395
154 3300038395 Ga0415639_019488 Ga0415639_019488_432_1619 395
155 3300042599 Ga0466706_179574 Ga0466706_179574_2598_3785 395
156 3300042619 Ga0466726_108283 Ga0466726_108283_10723_11910 395
157 iso_pr_bacteria 2820623020 2820623946 395
158 3300009826 Ga0123355_10000169 Ga0123355_100001698 396
159 3300009826 Ga0123355_10315696 Ga0123355_103156963 396
160 3300042596 Ga0466696_220553 Ga0466696_220553_1133_2323 396
161 3300042601 Ga0466707_207148 Ga0466707_207148_18228_19418 396
162 3300000062 IMNBL1DRAFT_c0000422 IMNBL1DRAFT_000042242 397
163 3300010882 Ga0123354_10015872 Ga0123354_100158728 397
164 3300042656 Ga0466732_196541 Ga0466732_196541_12236_13429 397
165 3300009826 Ga0123355_10036309 Ga0123355_100363095 398
166 iso_pr_bacteria 2820406809 2820408010 398
167 3300042600 Ga0466700_067571 Ga0466700_067571_997_2196 399
168 3300042636 Ga0466703_177121 Ga0466703_177121_794_1993 399
169 3300042636 Ga0466703_191444 Ga0466703_191444_513_1712 399
170 3300042612 Ga0466705_163322 Ga0466705_163322_40367_41572 401
171 3300042643 Ga0466704_217687 Ga0466704_217687_30249_31454 401
172 3300042656 Ga0466732_112578 Ga0466732_112578_1460_2665 401
173 3300042603 Ga0466714_065131 Ga0466714_065131_51813_53021 402
174 3300042606 Ga0466719_067204 Ga0466719_067204_4283_5491 402
175 3300042636 Ga0466703_065686 Ga0466703_065686_9563_10771 402
176 3300042590 Ga0466690_071587 Ga0466690_071587_1031_2242 403
177 3300042593 Ga0466691_032116 Ga0466691_032116_3840_5051 403
178 3300042599 Ga0466706_156785 Ga0466706_156785_1367_2578 403
179 3300042615 Ga0466711_245138 Ga0466711_245138_3440_4651 403
180 3300042619 Ga0466726_176348 Ga0466726_176348_169_1380 403
181 3300042599 Ga0466706_288143 Ga0466706_288143_491_1705 404
182 3300042601 Ga0466707_123662 Ga0466707_123662_10338_11564 408
183 3300007733 Ga0105524_105363 Ga0105524_1053632 411
184 3300042648 Ga0466709_261935 Ga0466709_261935_18152_19396 414
185 3300042652 Ga0466708_270559 Ga0466708_270559_1008_2252 414
186 3300042599 Ga0466706_108854 Ga0466706_108854_1865_3118 417
187 3300042594 Ga0466694_196685 Ga0466694_196685_1933_3300 455

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01855 POR_N Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg 79 302 0.98
PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II 325 428 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01855 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.