Protein Family IF04998

Metagenome Isolate
157 Members
53 Samples
147 Scaffolds
212.73 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_116026|Ga0466694_116026_16654_17403
Length
249 aa
Sequence
VLKIYNSRRRLTPEDSLYFVRLKIFAGFVYNKTGAKMIELAVFFGNPGTEYASNRHNAGRMLAQALPIYTSLSWQKKFKGLYAFNEGSHFLMPETYMNLSGESVFAAASFYKIKIEQIIVVHDELELPLGTISLKFSGGLGGHNGLRSMKQCFGNADFWRLRIGLGRPDSRLPGEGGRGGLENRESGEGIVDWVLSDFSCVEKEALAPVFESGASLLIQAMNVDPQTLLPEWAKKKINIAAKEENNDSR

📊 Sample Types

Isolate 6.4%
Metagenome 93.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.1%
Kalotermitidae 23.5%
Unclassified 21.6%
Rhinotermitidae 5.9%
Termopsidae 5.9%

🌳 Taxonomy

Archaea 1
Bacteria 140
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
24 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
25 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
41 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
42 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
46 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
47 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
48 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
49 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
50 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
51 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_058793 3300042656 Bacteria 1717
2 Ga0123356_10026863 3300010049 Bacteria 5398
3 Ga0123356_10028400 3300010049 Unclassified 5241
4 Ga0123353_10153152 3300010167 Bacteria 3679
5 Ga0264413_101220 3300024493 Bacteria 47245
6 Ga0415639_117602 3300038395 Bacteria 4131
7 Ga0466694_116026 3300042594 Bacteria 17934
8 Ga0466699_300572 3300042597 Bacteria 3097
9 Ga0466704_147969 3300042643 Unclassified 7871
10 Ga0466704_202884 3300042643 Bacteria 2075
11 Ga0466707_316679 3300042601 Bacteria 1023
12 Ga0466712_227385 3300042614 Bacteria 1542
13 Ga0466712_299142 3300042614 Bacteria 10125
14 Ga0466711_122592 3300042615 Bacteria 2590
15 Ga0466726_331156 3300042619 Archaea 1508
16 JGI24698J34947_10006637 3300002449 Bacteria 6356
17 JGI24698J34947_10009209 3300002449 Bacteria 5419
18 JGI24698J34947_10065161 3300002449 Unclassified 1777
19 JGI24695J34938_10001293 3300002450 Bacteria 21940
20 JGI24695J34938_10001758 3300002450 Bacteria 17891
21 JGI24695J34938_10068938 3300002450 Bacteria 1484
22 JGI24697J35500_11273289 3300002507 Unclassified 5519
23 Ga0072941_1052663 3300005201 Bacteria 1025
24 Ga0123356_10130594 3300010049 Bacteria 2460
25 Ga0123356_10136799 3300010049 Bacteria 2410
26 Ga0123353_10007548 3300010167 Bacteria 14727
27 Ga0466690_120585 3300042590 Bacteria 5733
28 Ga0466731_425692 3300042622 Bacteria 1402
29 Ga0466709_263566 3300042648 Unclassified 4557
30 Ga0466708_147157 3300042652 Bacteria 5932
31 Ga0466727_139071 3300042655 Bacteria 4209
32 Ga0466720_035637 3300042607 Bacteria 1734
33 Ga0466712_194073 3300042614 Bacteria 10983
34 Ga0466715_284748 3300042616 Bacteria 33200
35 Ga0466726_360511 3300042619 Unclassified 1467
36 JGI24698J34947_10005756 3300002449 Bacteria 6796
37 JGI24700J35501_10834935 3300002508 Bacteria 1814
38 Ga0123356_10000454 3300010049 Bacteria 46012
39 Ga0123356_10023032 3300010049 Bacteria 5870
40 Ga0123353_10304190 3300010167 Bacteria 2432
41 Ga0466691_002695 3300042593 Bacteria 29435
42 Ga0466691_061063 3300042593 Bacteria 9624
43 Ga0466731_270198 3300042622 Bacteria 1295
44 Ga0466703_177275 3300042636 Bacteria 42729
45 Ga0466704_583556 3300042643 Bacteria 17730
46 Ga0466708_223819 3300042652 Bacteria 4810
47 Ga0466700_066888 3300042600 Bacteria 2846
48 Ga0466720_015977 3300042607 Bacteria 14141
49 Ga0466722_012195 3300042609 Bacteria 4696
50 Ga0466712_049671 3300042614 Bacteria 6385
51 Ga0466712_259339 3300042614 Bacteria 4096
52 JGI24698J34947_10075870 3300002449 Bacteria 1596
53 Ga0123356_10000624 3300010049 Bacteria 39100
54 Ga0123356_11215057 3300010049 Bacteria 919
55 Ga0123356_11530297 3300010049 Bacteria 824
56 Ga0415639_022950 3300038395 Bacteria 10341
57 Ga0466692_155126 3300042591 Bacteria 2075
58 Ga0466696_198633 3300042596 Bacteria 12905
59 Ga0466729_225272 3300042621 Bacteria 1280
60 Ga0466717_271457 3300042604 Bacteria 1163
61 Ga0466712_004752 3300042614 Bacteria 3666
62 Ga0466712_072051 3300042614 Bacteria 23884
63 Ga0466712_233424 3300042614 Bacteria 2474
64 Ga0466723_266535 3300042618 Bacteria 11967
65 Ga0466726_035181 3300042619 Bacteria 2480
66 JGI24698J34947_10028952 3300002449 Bacteria 2931
67 Ga0072941_1008248 3300005201 Bacteria 12080
68 Ga0072941_1036346 3300005201 Bacteria 1687
69 Ga0466705_336433 3300042612 Unclassified 4131
70 Ga0123356_10025561 3300010049 Bacteria 5550
71 Ga0123353_10081628 3300010167 Bacteria 5199
72 Ga0123353_10217903 3300010167 Bacteria 2988
73 Ga0415639_076684 3300038395 Bacteria 4913
74 Ga0466696_090089 3300042596 Bacteria 1443
75 Ga0466731_203709 3300042622 Unclassified 1020
76 Ga0466735_131689 3300042624 Bacteria 1543
77 Ga0466708_107238 3300042652 Bacteria 24038
78 Ga0466727_104177 3300042655 Bacteria 1750
79 Ga0466721_232641 3300042608 Bacteria 2670
80 Ga0466722_036821 3300042609 Bacteria 1051
81 Ga0466712_009954 3300042614 Bacteria 9507
82 Ga0466712_289776 3300042614 Bacteria 27357
83 Ga0466711_116093 3300042615 Bacteria 4264
84 AustNasuHG_c1004095 3300000089 Bacteria 5238
85 Ga0466705_122991 3300042612 Unclassified 3628
86 Ga0466732_041243 3300042656 Bacteria 5736
87 Ga0123356_10007516 3300010049 Bacteria 10864
88 Ga0123353_11073698 3300010167 Unclassified 1072
89 Ga0466696_123055 3300042596 Bacteria 16521
90 Ga0466731_057013 3300042622 Bacteria 49553
91 Ga0466731_183486 3300042622 Bacteria 3923
92 Ga0466707_000975 3300042601 Bacteria 1103
93 Ga0466707_200988 3300042601 Bacteria 7366
94 Ga0466719_372001 3300042606 Bacteria 15055
95 Ga0466712_001885 3300042614 Bacteria 9309
96 Ga0466726_001787 3300042619 Bacteria 1873
97 Ga0466726_494002 3300042619 Unclassified 1560
98 JGI24698J34947_10023252 3300002449 Bacteria 3317
99 JGI24698J34947_10042266 3300002449 Bacteria 2343
100 JGI24698J34947_10044798 3300002449 Bacteria 2262
101 JGI24695J34938_10000090 3300002450 Bacteria 79670
102 JGI24695J34938_10000341 3300002450 Bacteria 46027
103 Ga0072940_1012279 3300005200 Bacteria 17174
104 Ga0466705_059310 3300042612 Bacteria 4919
105 Ga0415639_026713 3300038395 Bacteria 6865
106 Ga0466731_080485 3300042622 Bacteria 1163
107 Ga0466702_008851 3300042635 Bacteria 1200
108 Ga0466703_078559 3300042636 Bacteria 3887
109 Ga0466704_059474 3300042643 Bacteria 8080
110 Ga0466700_077650 3300042600 Bacteria 1278
111 Ga0466720_159486 3300042607 Bacteria 1502
112 Ga0466712_053113 3300042614 Bacteria 11639
113 Ga0466712_090702 3300042614 Bacteria 15005
114 Ga0466712_206744 3300042614 Bacteria 4863
115 Ga0466712_236994 3300042614 Unclassified 2251
116 Ga0466715_309831 3300042616 Bacteria 1557
117 Ga0466715_345203 3300042616 Bacteria 7760
118 Ga0466723_326899 3300042618 Bacteria 5743
119 JGI24695J34938_10059535 3300002450 Bacteria 1633
120 Ga0072941_1144569 3300005201 Bacteria 4028
121 Ga0466733_064703 3300042659 Bacteria 1631
122 Ga0123355_11351557 3300009826 Bacteria 709
123 Ga0123356_10076954 3300010049 Bacteria 3145
124 Ga0123356_10271217 3300010049 Bacteria 1787
125 Ga0466692_004082 3300042591 Bacteria 1201
126 Ga0466699_388666 3300042597 Unclassified 1669
127 Ga0466735_188905 3300042624 Bacteria 1019
128 Ga0466702_060692 3300042635 Bacteria 1234
129 Ga0466703_045349 3300042636 Unclassified 3365
130 Ga0466707_047199 3300042601 Unclassified 2932
131 Ga0466707_097853 3300042601 Bacteria 2467
132 Ga0466707_334456 3300042601 Bacteria 1078
133 Ga0466722_253337 3300042609 Bacteria 1520
134 Ga0466698_248910 3300042610 Bacteria 3010
135 Ga0466712_031932 3300042614 Bacteria 31317
136 Ga0466712_032344 3300042614 Bacteria 20671
137 Ga0466712_155391 3300042614 Bacteria 4723
138 Ga0466715_625328 3300042616 Bacteria 3958
139 Ga0466726_039827 3300042619 Bacteria 1833
140 AustNasuHG_c1015590 3300000089 Bacteria 2561
141 JGI24698J34947_10000307 3300002449 Bacteria 21485
142 JGI24698J34947_10003378 3300002449 Bacteria 8662
143 JGI24698J34947_10004609 3300002449 Bacteria 7513
144 JGI24698J34947_10023605 3300002449 Unclassified 3290
145 JGI24698J34947_10056457 3300002449 Bacteria 1952
146 JGI24695J34938_10000234 3300002450 Bacteria 52922
147 Ga0072941_1000337 3300005201 Bacteria 38663

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_122991 Ga0466705_122991_2134_2760 172
2 iso_pr_bacteria 2781125653 2781313874 189
3 3300005201 Ga0072941_1144569 Ga0072941_11445694 191
4 3300042601 Ga0466707_000975 Ga0466707_000975_84_674 196
5 3300042624 Ga0466735_188905 Ga0466735_188905_52_642 196
6 3300042643 Ga0466704_202884 Ga0466704_202884_916_1509 197
7 3300042601 Ga0466707_047199 Ga0466707_047199_71_667 198
8 3300042601 Ga0466707_334456 Ga0466707_334456_84_683 199
9 3300000089 AustNasuHG_c1015590 AustNasuHG_10155902 200
10 3300002449 JGI24698J34947_10004609 JGI24698J34947_100046094 200
11 3300042600 Ga0466700_066888 Ga0466700_066888_734_1336 200
12 3300010049 Ga0123356_10007516 Ga0123356_100075165 201
13 3300010049 Ga0123356_10026863 Ga0123356_100268637 201
14 3300010049 Ga0123356_11530297 Ga0123356_115302971 201
15 3300042600 Ga0466700_077650 Ga0466700_077650_64_669 201
16 3300042601 Ga0466707_097853 Ga0466707_097853_893_1498 201
17 3300042616 Ga0466715_625328 Ga0466715_625328_737_1393 201
18 3300005200 Ga0072940_1012279 Ga0072940_10122795 202
19 3300042607 Ga0466720_035637 Ga0466720_035637_924_1532 202
20 3300042607 Ga0466720_159486 Ga0466720_159486_300_908 202
21 3300005201 Ga0072941_1000337 Ga0072941_100033724 203
22 3300042614 Ga0466712_072051 Ga0466712_072051_18847_19458 203
23 3300042614 Ga0466712_155391 Ga0466712_155391_69_680 203
24 3300042614 Ga0466712_236994 Ga0466712_236994_1580_2191 203
25 3300042614 Ga0466712_299142 Ga0466712_299142_2205_2816 203
26 3300002449 JGI24698J34947_10000307 JGI24698J34947_100003079 204
27 3300002449 JGI24698J34947_10075870 JGI24698J34947_100758702 204
28 3300042608 Ga0466721_232641 Ga0466721_232641_389_1003 204
29 3300042614 Ga0466712_049671 Ga0466712_049671_4731_5345 204
30 3300042622 Ga0466731_057013 Ga0466731_057013_11784_12398 204
31 3300038395 Ga0415639_022950 Ga0415639_022950_2367_2984 205
32 3300042607 Ga0466720_015977 Ga0466720_015977_9845_10462 205
33 3300042614 Ga0466712_090702 Ga0466712_090702_6013_6630 205
34 3300042619 Ga0466726_360511 Ga0466726_360511_750_1415 205
35 3300042621 Ga0466729_225272 Ga0466729_225272_407_1024 205
36 3300042636 Ga0466703_078559 Ga0466703_078559_424_1056 205
37 iso_pr_bacteria 2781125637 2781282975 205
38 3300002449 JGI24698J34947_10023252 JGI24698J34947_100232522 206
39 3300005201 Ga0072941_1008248 Ga0072941_10082487 206
40 3300005201 Ga0072941_1036346 Ga0072941_10363462 206
41 3300010167 Ga0123353_10007548 Ga0123353_100075489 206
42 3300042614 Ga0466712_206744 Ga0466712_206744_40_660 206
43 3300042635 Ga0466702_008851 Ga0466702_008851_36_656 206
44 iso_pr_bacteria 2781125636 2781280350 206
45 iso_pr_bacteria 2781125646 2781301516 206
46 3300002449 JGI24698J34947_10003378 JGI24698J34947_100033785 207
47 3300002450 JGI24695J34938_10000090 JGI24695J34938_1000009081 207
48 3300002450 JGI24695J34938_10000341 JGI24695J34938_100003418 207
49 3300042614 Ga0466712_004752 Ga0466712_004752_333_956 207
50 3300042614 Ga0466712_009954 Ga0466712_009954_1082_1705 207
51 3300042614 Ga0466712_227385 Ga0466712_227385_266_889 207
52 3300002449 JGI24698J34947_10023605 JGI24698J34947_100236053 208
53 3300002449 JGI24698J34947_10028952 JGI24698J34947_100289523 208
54 3300002449 JGI24698J34947_10044798 JGI24698J34947_100447982 208
55 3300002449 JGI24698J34947_10065161 JGI24698J34947_100651612 208
56 3300002507 JGI24697J35500_11273289 JGI24697J35500_112732895 208
57 3300010049 Ga0123356_10025561 Ga0123356_100255615 208
58 3300038395 Ga0415639_076684 Ga0415639_076684_899_1525 208
59 3300042614 Ga0466712_233424 Ga0466712_233424_40_666 208
60 3300042622 Ga0466731_183486 Ga0466731_183486_2399_3025 208
61 3300010049 Ga0123356_10076954 Ga0123356_100769543 209
62 3300024493 Ga0264413_101220 Ga0264413_10122019 209
63 3300038395 Ga0415639_117602 Ga0415639_117602_1841_2470 209
64 3300042614 Ga0466712_031932 Ga0466712_031932_25644_26273 209
65 3300042614 Ga0466712_259339 Ga0466712_259339_1055_1684 209
66 3300042619 Ga0466726_035181 Ga0466726_035181_1147_1776 209
67 3300042622 Ga0466731_425692 Ga0466731_425692_225_854 209
68 iso_pr_bacteria 2781125635 2781277585 209
69 iso_pr_bacteria 2781125645 2781298594 209
70 iso_pr_bacteria 2781125659 2781328746 209
71 3300010049 Ga0123356_10023032 Ga0123356_100230324 210
72 3300010049 Ga0123356_10136799 Ga0123356_101367992 210
73 3300042619 Ga0466726_331156 Ga0466726_331156_612_1244 210
74 3300010049 Ga0123356_10130594 Ga0123356_101305942 211
75 3300038395 Ga0415639_026713 Ga0415639_026713_2760_3395 211
76 3300042609 Ga0466722_036821 Ga0466722_036821_178_813 211
77 3300042655 Ga0466727_139071 Ga0466727_139071_626_1279 211
78 3300002450 JGI24695J34938_10059535 JGI24695J34938_100595352 212
79 3300002450 JGI24695J34938_10068938 JGI24695J34938_100689382 212
80 3300010049 Ga0123356_11215057 Ga0123356_112150571 212
81 3300010167 Ga0123353_10081628 Ga0123353_100816285 212
82 3300042624 Ga0466735_131689 Ga0466735_131689_483_1121 212
83 3300042652 Ga0466708_147157 Ga0466708_147157_2308_3117 212
84 3300002450 JGI24695J34938_10001758 JGI24695J34938_100017583 213
85 3300042596 Ga0466696_090089 Ga0466696_090089_327_1028 213
86 3300042614 Ga0466712_032344 Ga0466712_032344_12643_13284 213
87 3300042619 Ga0466726_001787 Ga0466726_001787_892_1533 213
88 3300042643 Ga0466704_059474 Ga0466704_059474_3438_4079 213
89 3300042643 Ga0466704_147969 Ga0466704_147969_3485_4126 213
90 3300042652 Ga0466708_223819 Ga0466708_223819_1761_2402 213
91 3300002450 JGI24695J34938_10001293 JGI24695J34938_1000129315 214
92 3300042591 Ga0466692_155126 Ga0466692_155126_830_1501 214
93 3300042612 Ga0466705_059310 Ga0466705_059310_1169_1813 214
94 3300042614 Ga0466712_194073 Ga0466712_194073_4612_5256 214
95 3300042622 Ga0466731_080485 Ga0466731_080485_412_1056 214
96 3300042622 Ga0466731_270198 Ga0466731_270198_299_943 214
97 3300042610 Ga0466698_248910 Ga0466698_248910_748_1395 215
98 3300042622 Ga0466731_203709 Ga0466731_203709_332_979 215
99 3300042614 Ga0466712_289776 Ga0466712_289776_13979_14629 216
100 iso_pr_bacteria 2781125662 2781336331 216
101 3300005201 Ga0072941_1052663 Ga0072941_10526631 217
102 3300010049 Ga0123356_10000454 Ga0123356_1000045424 217
103 3300042597 Ga0466699_388666 Ga0466699_388666_155_808 217
104 3300042609 Ga0466722_012195 Ga0466722_012195_399_1052 217
105 3300002449 JGI24698J34947_10056457 JGI24698J34947_100564572 218
106 3300002450 JGI24695J34938_10000234 JGI24695J34938_100002343 218
107 3300010049 Ga0123356_10028400 Ga0123356_100284005 218
108 3300042593 Ga0466691_061063 Ga0466691_061063_3764_4420 218
109 3300042606 Ga0466719_372001 Ga0466719_372001_12250_12906 218
110 3300042612 Ga0466705_336433 Ga0466705_336433_3142_3798 218
111 3300042636 Ga0466703_045349 Ga0466703_045349_2259_2915 218
112 3300042643 Ga0466704_583556 Ga0466704_583556_12991_13647 218
113 iso_pr_bacteria 2781125661 2781332995 218
114 3300002449 JGI24698J34947_10005756 JGI24698J34947_100057564 219
115 3300010049 Ga0123356_10000624 Ga0123356_1000062424 219
116 3300010049 Ga0123356_10271217 Ga0123356_102712172 219
117 3300042590 Ga0466690_120585 Ga0466690_120585_1374_2033 219
118 3300042593 Ga0466691_002695 Ga0466691_002695_9818_10477 219
119 3300042601 Ga0466707_200988 Ga0466707_200988_1005_1664 219
120 3300002449 JGI24698J34947_10009209 JGI24698J34947_100092092 220
121 3300002449 JGI24698J34947_10042266 JGI24698J34947_100422664 220
122 3300042601 Ga0466707_316679 Ga0466707_316679_168_830 220
123 3300042616 Ga0466715_309831 Ga0466715_309831_46_708 220
124 3300042656 Ga0466732_058793 Ga0466732_058793_222_884 220
125 iso_pr_bacteria 2781125694 2781436766 220
126 3300000089 AustNasuHG_c1004095 AustNasuHG_10040955 221
127 3300009826 Ga0123355_11351557 Ga0123355_113515571 221
128 3300010167 Ga0123353_10153152 Ga0123353_101531524 221
129 3300010167 Ga0123353_10217903 Ga0123353_102179033 221
130 3300042619 Ga0466726_039827 Ga0466726_039827_328_993 221
131 3300042614 Ga0466712_001885 Ga0466712_001885_6531_7199 222
132 3300042615 Ga0466711_122592 Ga0466711_122592_1033_1701 222
133 3300042659 Ga0466733_064703 Ga0466733_064703_101_769 222
134 3300010167 Ga0123353_10304190 Ga0123353_103041903 223
135 3300042591 Ga0466692_004082 Ga0466692_004082_345_1016 223
136 3300042616 Ga0466715_345203 Ga0466715_345203_61_732 223
137 3300042618 Ga0466723_266535 Ga0466723_266535_10497_11168 223
138 3300042635 Ga0466702_060692 Ga0466702_060692_491_1162 223
139 3300042652 Ga0466708_107238 Ga0466708_107238_10918_11616 223
140 3300042619 Ga0466726_494002 Ga0466726_494002_119_793 224
141 3300042655 Ga0466727_104177 Ga0466727_104177_323_997 224
142 3300042614 Ga0466712_053113 Ga0466712_053113_4423_5100 225
143 3300042616 Ga0466715_284748 Ga0466715_284748_7095_7772 225
144 3300002449 JGI24698J34947_10006637 JGI24698J34947_100066376 226
145 3300042604 Ga0466717_271457 Ga0466717_271457_109_831 227
146 3300042636 Ga0466703_177275 Ga0466703_177275_27523_28206 227
147 3300002508 JGI24700J35501_10834935 JGI24700J35501_108349353 228
148 3300010167 Ga0123353_11073698 Ga0123353_110736982 228
149 3300042648 Ga0466709_263566 Ga0466709_263566_3505_4194 229
150 3300042656 Ga0466732_041243 Ga0466732_041243_4160_4852 230
151 3300042615 Ga0466711_116093 Ga0466711_116093_2985_3686 233
152 3300042609 Ga0466722_253337 Ga0466722_253337_194_898 234
153 3300042596 Ga0466696_198633 Ga0466696_198633_7623_8333 236
154 3300042597 Ga0466699_300572 Ga0466699_300572_796_1509 237
155 3300042596 Ga0466696_123055 Ga0466696_123055_13022_13753 243
156 3300042618 Ga0466723_326899 Ga0466723_326899_2779_3519 246
157 3300042594 Ga0466694_116026 Ga0466694_116026_16654_17403 249

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase 41 221 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01195 GO:0004045 aminoacyl-tRNA hydrolase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.