Protein Family IF04966

Metagenome Isolate
160 Members
60 Samples
144 Scaffolds
480.3 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_023612|Ga0466694_023612_5398_7050
Length
550 aa
Sequence
MDSASTGMAFVSLLTMHDDNANSVNRDSTIKCIPVFFADMADSPLVDIFILLYPQKGNYTMKKFMDNNFLLSTKTAKKLYHEAAKAEPIFDYHCHLIPQEIAEDRRFPDLASVWLGGDHYKWRAMRANGVSEMLVTGKAEPYEKFLAWADTVPRLIGNPLYHWTHLELRRYFDISEPLNPHSAPAIWKAANERLARDTSLSVFGIFKKFNVFATGTTDDPADSLEWHKKVYAQGATGTKVLPSFRPDRIINIEKPDFAEYIARLAQAAGTRINSLDDLLRVIQNRIAFFHDASCRICDHGLDYVPFATASDDPCLARPAEINFSKWEKEMKDIFARALNGKKPNAAETESWKTFLLNFLGEEYAERDWAMQIHLAAIRSNNTAALTALGPDTGYDAVHDYPAAEKLARLMDLLFSRDKLPKTILYSLNIKDLYPLATLMGCFQGEINPAKQVIPGKIQLGSGWWFLDHIDGMETQMRLLGNTGLLSRFVGMLTDSRSFLSYPRHEYFRRILCNILGTWAENGEIPNDFDLLGGMVRDISFRNAQRYFNVP

📊 Sample Types

Isolate 10.0%
Metagenome 90.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.8%
Kalotermitidae 20.7%
Unclassified 19.0%
Termopsidae 3.4%
Culicidae 3.4%
Rhinotermitidae 3.4%
Pyrrhocoridae 1.7%
Hodotermitidae 1.7%
Passalidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 159
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
2 2593339124 Clostridium sp. 4 Isolate Termitidae
3 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
4 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
5 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
6 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
7 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
8 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
9 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
10 2964130733 Entomospira entomophilus BR193 Isolate Culicidae
11 650716102 Treponema primitia ZAS-2 Isolate Unclassified
12 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
13 2590828840 Clostridium sp. 2 Isolate Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
21 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
22 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
23 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 8063587521 Entomospira entomophilus BR193 Isolate Culicidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
37 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
38 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
44 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
45 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
47 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
48 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
51 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
52 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
55 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
56 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
57 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
58 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
59 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
60 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_073836 3300042624 Bacteria 12411
2 Ga0466712_038659 3300042614 Bacteria 14039
3 Ga0466712_124345 3300042614 Bacteria 4494
4 Ga0466712_157055 3300042614 Bacteria 9381
5 Ga0466718_063528 3300042617 Bacteria 34799
6 Ga0123355_10038761 3300009826 Bacteria 7749
7 Ga0123353_10065114 3300010167 Bacteria 5850
8 JGI24698J34947_10005777 3300002449 Bacteria 6784
9 JGI24698J34947_10021278 3300002449 Bacteria 3491
10 JGI24695J34938_10045681 3300002450 Bacteria 1942
11 Ga0072941_1039562 3300005201 Bacteria 10220
12 Ga0074263_108805 3300005485 Bacteria 3160
13 Ga0466690_004723 3300042590 Bacteria 6569
14 Ga0466692_049282 3300042591 Bacteria 249845
15 Ga0466692_203453 3300042591 Bacteria 53264
16 Ga0466691_073234 3300042593 Bacteria 9834
17 Ga0466706_117928 3300042599 Bacteria 4065
18 Ga0466714_007774 3300042603 Bacteria 3128
19 Ga0466720_131630 3300042607 Bacteria 8215
20 Ga0466710_364278 3300042613 Bacteria 1755
21 Ga0466712_323757 3300042614 Bacteria 19517
22 Ga0466715_227450 3300042616 Bacteria 2129
23 JGI24702J35022_10035693 3300002462 Bacteria 2659
24 JGI24699J35502_11133802 3300002509 Bacteria 15866
25 Ga0466690_329394 3300042590 Bacteria 2489
26 Ga0466694_238586 3300042594 Bacteria 7384
27 Ga0466699_051384 3300042597 Bacteria 2104
28 Ga0466700_433098 3300042600 Bacteria 2290
29 Ga0466719_564777 3300042606 Bacteria 7476
30 Ga0466720_062662 3300042607 Bacteria 2898
31 Ga0466720_065521 3300042607 Bacteria 16476
32 Ga0466722_044747 3300042609 Bacteria 5923
33 Ga0466722_249795 3300042609 Bacteria 5040
34 Ga0466732_084693 3300042656 Bacteria 1709
35 Ga0466732_186284 3300042656 Bacteria 12295
36 Ga0466735_164818 3300042624 Bacteria 7353
37 Ga0466704_458279 3300042643 Bacteria 24853
38 Ga0466711_245235 3300042615 Bacteria 1577
39 Ga0466715_094219 3300042616 Bacteria 2572
40 Ga0123353_10148134 3300010167 Bacteria 3751
41 JGI24698J34947_10004093 3300002449 Bacteria 7909
42 JGI24698J34947_10025936 3300002449 Bacteria 3116
43 Ga0264413_112015 3300024493 Bacteria 8163
44 Ga0466696_139924 3300042596 Bacteria 3498
45 Ga0466699_033001 3300042597 Bacteria 5237
46 Ga0466720_014365 3300042607 Bacteria 9932
47 Ga0466720_035963 3300042607 Bacteria 10782
48 Ga0466720_051984 3300042607 Bacteria 7546
49 Ga0466720_162180 3300042607 Bacteria 6221
50 Ga0466722_170430 3300042609 Bacteria 2686
51 Ga0466722_188485 3300042609 Bacteria 26025
52 Ga0466722_233804 3300042609 Bacteria 6556
53 Ga0466705_071813 3300042612 Bacteria 7493
54 Ga0466732_317539 3300042656 Bacteria 6345
55 Ga0466733_174779 3300042659 Bacteria 4975
56 Ga0466712_139828 3300042614 Bacteria 5364
57 Ga0466715_268369 3300042616 Bacteria 12554
58 Ga0466718_012170 3300042617 Bacteria 13318
59 Ga0123356_10004081 3300010049 Bacteria 15173
60 Ga0123353_10010513 3300010167 Bacteria 12907
61 JGI24698J34947_10050164 3300002449 Bacteria 2106
62 JGI24700J35501_10929179 3300002508 Bacteria 8775
63 Ga0072941_1021487 3300005201 Bacteria 7100
64 Ga0072941_1023651 3300005201 Bacteria 12237
65 Ga0466699_196105 3300042597 Bacteria 4294
66 Ga0466699_242223 3300042597 Bacteria 8789
67 Ga0466699_247440 3300042597 Bacteria 3596
68 Ga0466722_022028 3300042609 Bacteria 2817
69 Ga0466722_155137 3300042609 Bacteria 18198
70 Ga0466705_005355 3300042612 Bacteria 12648
71 Ga0466705_128834 3300042612 Bacteria 4891
72 Ga0466703_219990 3300042636 Bacteria 4109
73 Ga0123356_10000717 3300010049 Bacteria 36766
74 Ga0123356_10019397 3300010049 Bacteria 6445
75 Ga0123356_10182687 3300010049 Bacteria 2121
76 Ga0123353_10039734 3300010167 Bacteria 7413
77 Ga0123353_10171081 3300010167 Bacteria 3449
78 IMNBL1DRAFT_c0008616 3300000062 Bacteria 5171
79 AustNasuHG_c1001364 3300000089 Bacteria 8743
80 JGI24698J34947_10008462 3300002449 Bacteria 5649
81 JGI24698J34947_10031653 3300002449 Unclassified 2782
82 JGI24695J34938_10016640 3300002450 Bacteria 3733
83 Ga0072941_1021488 3300005201 Bacteria 9559
84 Ga0466692_058889 3300042591 Bacteria 41705
85 Ga0466699_245407 3300042597 Bacteria 4524
86 Ga0466699_292240 3300042597 Bacteria 2077
87 Ga0466720_027911 3300042607 Bacteria 16141
88 Ga0466722_016522 3300042609 Bacteria 2571
89 Ga0466732_175544 3300042656 Bacteria 18837
90 Ga0466733_176135 3300042659 Bacteria 9521
91 Ga0466708_093717 3300042652 Bacteria 8976
92 Ga0466727_079547 3300042655 Bacteria 8888
93 Ga0466711_152881 3300042615 Bacteria 23786
94 Ga0466723_086483 3300042618 Bacteria 21486
95 Ga0123355_10000276 3300009826 Bacteria 66090
96 Ga0123356_10039014 3300010049 Bacteria 4425
97 Ga0123354_10226406 3300010882 Bacteria 1969
98 Ga0123354_10299907 3300010882 Bacteria 1522
99 Ga0264413_112230 3300024493 Bacteria 9505
100 Ga0466692_047953 3300042591 Bacteria 13865
101 Ga0466720_030042 3300042607 Bacteria 20620
102 Ga0466720_163924 3300042607 Bacteria 3776
103 Ga0466722_195495 3300042609 Bacteria 4490
104 Ga0466732_111305 3300042656 Bacteria 5379
105 Ga0466735_025797 3300042624 Bacteria 2391
106 Ga0466709_406816 3300042648 Bacteria 10177
107 Ga0466712_044752 3300042614 Bacteria 8502
108 Ga0466711_308404 3300042615 Bacteria 17331
109 Ga0466723_077817 3300042618 Bacteria 8804
110 JGI24698J34947_10004408 3300002449 Bacteria 7663
111 JGI24698J34947_10006183 3300002449 Bacteria 6576
112 Ga0072941_1017510 3300005201 Bacteria 10966
113 Ga0264413_158263 3300024493 Bacteria 3059
114 Ga0466694_023612 3300042594 Bacteria 17845
115 Ga0466694_294101 3300042594 Bacteria 3239
116 Ga0466699_005029 3300042597 Bacteria 8354
117 Ga0466699_023149 3300042597 Bacteria 14027
118 Ga0466699_026948 3300042597 Bacteria 6038
119 Ga0466699_058000 3300042597 Bacteria 7275
120 Ga0466699_114387 3300042597 Bacteria 28326
121 Ga0466699_204433 3300042597 Bacteria 21386
122 Ga0466719_244648 3300042606 Bacteria 13008
123 Ga0466720_093891 3300042607 Bacteria 26484
124 Ga0466720_158071 3300042607 Bacteria 21754
125 Ga0466720_160501 3300042607 Bacteria 20483
126 Ga0466722_039585 3300042609 Bacteria 7750
127 Ga0466698_214701 3300042610 Bacteria 2549
128 Ga0466698_398215 3300042610 Bacteria 8567
129 Ga0466733_023577 3300042659 Bacteria 8970
130 Ga0466712_111965 3300042614 Bacteria 5216
131 Ga0466711_027826 3300042615 Bacteria 7078
132 Ga0123356_10010310 3300010049 Bacteria 9175
133 Ga0123353_10001115 3300010167 Bacteria 32664
134 JGI24698J34947_10005973 3300002449 Bacteria 6681
135 JGI24705J35276_12235076 3300002504 Bacteria 6149
136 Ga0072941_1003019 3300005201 Bacteria 56162
137 Ga0264413_119285 3300024493 Bacteria 9882
138 Ga0466695_277493 3300042595 Bacteria 5042
139 Ga0466696_054381 3300042596 Bacteria 22881
140 Ga0466699_117245 3300042597 Bacteria 16245
141 Ga0466699_144985 3300042597 Bacteria 5083
142 Ga0466699_336695 3300042597 Bacteria 4269
143 Ga0466720_017908 3300042607 Bacteria 4552
144 Ga0466722_072715 3300042609 Bacteria 21761

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1021488 Ga0072941_10214885 409
2 3300042607 Ga0466720_062662 Ga0466720_062662_34_1305 423
3 3300042656 Ga0466732_084693 Ga0466732_084693_41_1315 424
4 3300024493 Ga0264413_158263 Ga0264413_1582632 443
5 3300010049 Ga0123356_10004081 Ga0123356_100040816 448
6 3300042659 Ga0466733_023577 Ga0466733_023577_6827_8224 452
7 iso_pr_bacteria 2820303403 2820304531 460
8 3300010049 Ga0123356_10039014 Ga0123356_100390144 462
9 3300002449 JGI24698J34947_10031653 JGI24698J34947_100316533 463
10 3300042615 Ga0466711_308404 Ga0466711_308404_8823_10214 463
11 iso_pr_bacteria 2820414148 2820414242 463
12 3300010167 Ga0123353_10001115 Ga0123353_1000111515 464
13 3300042597 Ga0466699_242223 Ga0466699_242223_4218_5612 464
14 3300002508 JGI24700J35501_10929179 JGI24700J35501_109291797 465
15 3300042624 Ga0466735_073836 Ga0466735_073836_8155_9552 465
16 3300042624 Ga0466735_164818 Ga0466735_164818_903_2300 465
17 3300002450 JGI24695J34938_10016640 JGI24695J34938_100166401 466
18 3300042591 Ga0466692_203453 Ga0466692_203453_16242_17681 466
19 iso_pr_bacteria 2590828840 2593254479 466
20 iso_pr_bacteria 2593339124 2595063872 466
21 3300005201 Ga0072941_1003019 Ga0072941_10030198 467
22 3300005201 Ga0072941_1021487 Ga0072941_10214871 467
23 3300010049 Ga0123356_10000717 Ga0123356_100007172 467
24 3300042600 Ga0466700_433098 Ga0466700_433098_800_2203 467
25 3300042615 Ga0466711_027826 Ga0466711_027826_2098_3501 467
26 iso_pr_bacteria 2820314258 2820315033 467
27 iso_pr_bacteria 2820318056 2820319319 467
28 3300000062 IMNBL1DRAFT_c0008616 IMNBL1DRAFT_00086166 468
29 3300002504 JGI24705J35276_12235076 JGI24705J35276_122350762 468
30 3300009826 Ga0123355_10000276 Ga0123355_1000027630 468
31 3300010049 Ga0123356_10010310 Ga0123356_100103101 468
32 3300010167 Ga0123353_10039734 Ga0123353_100397344 468
33 3300010167 Ga0123353_10065114 Ga0123353_100651143 468
34 3300010882 Ga0123354_10226406 Ga0123354_102264062 468
35 3300042614 Ga0466712_157055 Ga0466712_157055_5958_7364 468
36 iso_pr_bacteria 2964130733 2964131599 468
37 iso_pr_bacteria 8063587521 8063588386 468
38 3300010049 Ga0123356_10182687 Ga0123356_101826872 469
39 3300010167 Ga0123353_10148134 Ga0123353_101481342 469
40 3300042614 Ga0466712_323757 Ga0466712_323757_5150_6577 469
41 iso_pr_bacteria 2503538010 2503575338 469
42 3300002449 JGI24698J34947_10005777 JGI24698J34947_100057773 470
43 3300042603 Ga0466714_007774 Ga0466714_007774_719_2131 470
44 3300042614 Ga0466712_139828 Ga0466712_139828_2694_4106 470
45 3300042655 Ga0466727_079547 Ga0466727_079547_140_1627 470
46 3300042659 Ga0466733_174779 Ga0466733_174779_820_2232 470
47 3300042591 Ga0466692_049282 Ga0466692_049282_106331_107746 471
48 3300042609 Ga0466722_233804 Ga0466722_233804_399_1814 471
49 3300042613 Ga0466710_364278 Ga0466710_364278_298_1713 471
50 3300042616 Ga0466715_094219 Ga0466715_094219_786_2201 471
51 3300042609 Ga0466722_072715 Ga0466722_072715_15089_16507 472
52 3300042624 Ga0466735_025797 Ga0466735_025797_584_2002 472
53 3300005201 Ga0072941_1023651 Ga0072941_10236518 473
54 3300010167 Ga0123353_10010513 Ga0123353_100105138 474
55 3300042609 Ga0466722_155137 Ga0466722_155137_271_1695 474
56 3300042609 Ga0466722_170430 Ga0466722_170430_1051_2478 475
57 3300042659 Ga0466733_176135 Ga0466733_176135_6797_8224 475
58 3300010882 Ga0123354_10299907 Ga0123354_102999071 476
59 3300042609 Ga0466722_039585 Ga0466722_039585_4917_6350 477
60 3300042643 Ga0466704_458279 Ga0466704_458279_19671_21104 477
61 3300002449 JGI24698J34947_10004093 JGI24698J34947_100040936 478
62 3300024493 Ga0264413_119285 Ga0264413_1192855 478
63 3300042612 Ga0466705_071813 Ga0466705_071813_1035_2471 478
64 3300042648 Ga0466709_406816 Ga0466709_406816_358_1794 478
65 3300042590 Ga0466690_004723 Ga0466690_004723_4681_6120 479
66 3300042595 Ga0466695_277493 Ga0466695_277493_2389_3828 479
67 3300042606 Ga0466719_564777 Ga0466719_564777_1391_2830 479
68 3300042615 Ga0466711_152881 Ga0466711_152881_7052_8491 479
69 3300042618 Ga0466723_077817 Ga0466723_077817_4063_5502 479
70 3300042652 Ga0466708_093717 Ga0466708_093717_2960_4399 479
71 3300042656 Ga0466732_175544 Ga0466732_175544_7400_8839 479
72 3300042590 Ga0466690_329394 Ga0466690_329394_548_1990 480
73 3300042612 Ga0466705_128834 Ga0466705_128834_725_2167 480
74 iso_pr_bacteria 2781125693 2781433830 480
75 3300005201 Ga0072941_1039562 Ga0072941_10395625 481
76 3300042591 Ga0466692_047953 Ga0466692_047953_1355_2800 481
77 3300042614 Ga0466712_044752 Ga0466712_044752_5599_7044 481
78 3300042636 Ga0466703_219990 Ga0466703_219990_1305_2750 481
79 iso_pr_bacteria 2781125658 2781326510 481
80 3300002449 JGI24698J34947_10025936 JGI24698J34947_100259363 482
81 3300005201 Ga0072941_1017510 Ga0072941_10175103 482
82 3300010049 Ga0123356_10019397 Ga0123356_100193974 482
83 3300010167 Ga0123353_10171081 Ga0123353_101710812 482
84 3300042596 Ga0466696_139924 Ga0466696_139924_1546_2994 482
85 3300042612 Ga0466705_005355 Ga0466705_005355_4968_6416 482
86 3300042614 Ga0466712_124345 Ga0466712_124345_54_1502 482
87 3300042616 Ga0466715_268369 Ga0466715_268369_6768_8216 482
88 3300002449 JGI24698J34947_10005973 JGI24698J34947_100059732 483
89 3300042597 Ga0466699_117245 Ga0466699_117245_5293_6744 483
90 3300042593 Ga0466691_073234 Ga0466691_073234_2326_3780 484
91 3300042597 Ga0466699_026948 Ga0466699_026948_3659_5113 484
92 3300042597 Ga0466699_051384 Ga0466699_051384_622_2076 484
93 3300042607 Ga0466720_065521 Ga0466720_065521_10871_12325 484
94 3300042609 Ga0466722_016522 Ga0466722_016522_882_2336 484
95 3300042609 Ga0466722_249795 Ga0466722_249795_2521_3975 484
96 3300042615 Ga0466711_245235 Ga0466711_245235_93_1547 484
97 3300042656 Ga0466732_111305 Ga0466732_111305_315_1769 484
98 3300042656 Ga0466732_186284 Ga0466732_186284_10643_12097 484
99 3300002449 JGI24698J34947_10006183 JGI24698J34947_100061835 485
100 3300024493 Ga0264413_112230 Ga0264413_1122307 486
101 3300042607 Ga0466720_051984 Ga0466720_051984_4362_5822 486
102 3300042607 Ga0466720_162180 Ga0466720_162180_4051_5511 486
103 3300042597 Ga0466699_033001 Ga0466699_033001_2942_4405 487
104 3300042607 Ga0466720_158071 Ga0466720_158071_14259_15722 487
105 3300042614 Ga0466712_111965 Ga0466712_111965_2423_3886 487
106 3300042616 Ga0466715_227450 Ga0466715_227450_339_1802 487
107 3300042617 Ga0466718_012170 Ga0466718_012170_3875_5338 487
108 3300000089 AustNasuHG_c1001364 AustNasuHG_10013643 488
109 3300002449 JGI24698J34947_10008462 JGI24698J34947_100084622 488
110 3300002449 JGI24698J34947_10050164 JGI24698J34947_100501642 488
111 3300042597 Ga0466699_005029 Ga0466699_005029_6176_7642 488
112 3300042597 Ga0466699_144985 Ga0466699_144985_341_1807 488
113 3300042597 Ga0466699_196105 Ga0466699_196105_347_1813 488
114 3300042597 Ga0466699_292240 Ga0466699_292240_264_1730 488
115 3300042607 Ga0466720_035963 Ga0466720_035963_1394_2860 488
116 3300042609 Ga0466722_022028 Ga0466722_022028_245_1711 488
117 3300042609 Ga0466722_188485 Ga0466722_188485_5984_7450 488
118 3300042610 Ga0466698_214701 Ga0466698_214701_821_2287 488
119 3300042617 Ga0466718_063528 Ga0466718_063528_32868_34334 488
120 iso_pr_bacteria 2781125689 2781426806 488
121 3300002509 JGI24699J35502_11133802 JGI24699J35502_111338025 489
122 3300042607 Ga0466720_017908 Ga0466720_017908_2591_4060 489
123 3300042607 Ga0466720_160501 Ga0466720_160501_7909_9378 489
124 3300042614 Ga0466712_038659 Ga0466712_038659_8603_10072 489
125 3300024493 Ga0264413_112015 Ga0264413_1120152 490
126 3300042597 Ga0466699_058000 Ga0466699_058000_1678_3150 490
127 3300042597 Ga0466699_245407 Ga0466699_245407_2018_3490 490
128 3300042597 Ga0466699_247440 Ga0466699_247440_1985_3457 490
129 3300042597 Ga0466699_336695 Ga0466699_336695_2446_3918 490
130 3300042609 Ga0466722_195495 Ga0466722_195495_208_1680 490
131 iso_pr_bacteria 650716102 650884036 490
132 3300042597 Ga0466699_023149 Ga0466699_023149_2107_3582 491
133 3300042597 Ga0466699_114387 Ga0466699_114387_4706_6181 491
134 3300042597 Ga0466699_204433 Ga0466699_204433_18578_20053 491
135 3300042609 Ga0466722_044747 Ga0466722_044747_565_2040 491
136 3300042607 Ga0466720_014365 Ga0466720_014365_567_2045 492
137 3300042607 Ga0466720_027911 Ga0466720_027911_8182_9660 492
138 3300042607 Ga0466720_131630 Ga0466720_131630_922_2400 492
139 3300042607 Ga0466720_163924 Ga0466720_163924_402_1880 492
140 iso_pr_bacteria 2781125640 2781289350 492
141 3300002450 JGI24695J34938_10045681 JGI24695J34938_100456811 493
142 3300005485 Ga0074263_108805 Ga0074263_1088053 493
143 3300042596 Ga0466696_054381 Ga0466696_054381_12657_14138 493
144 3300042656 Ga0466732_317539 Ga0466732_317539_4664_6145 493
145 3300042610 Ga0466698_398215 Ga0466698_398215_834_2318 494
146 3300042594 Ga0466694_294101 Ga0466694_294101_211_1698 495
147 3300042618 Ga0466723_086483 Ga0466723_086483_3845_5335 496
148 3300042591 Ga0466692_058889 Ga0466692_058889_35221_36717 498
149 3300042594 Ga0466694_238586 Ga0466694_238586_325_1821 498
150 3300042599 Ga0466706_117928 Ga0466706_117928_190_1689 499
151 iso_pr_bacteria 2781125695 2781439809 499
152 3300002462 JGI24702J35022_10035693 JGI24702J35022_100356933 500
153 3300042607 Ga0466720_093891 Ga0466720_093891_8764_10266 500
154 iso_pr_bacteria 2781125682 2781408930 500
155 3300002449 JGI24698J34947_10021278 JGI24698J34947_100212783 503
156 3300042607 Ga0466720_030042 Ga0466720_030042_17301_18845 514
157 3300002449 JGI24698J34947_10004408 JGI24698J34947_100044085 522
158 3300042606 Ga0466719_244648 Ga0466719_244648_2850_4463 537
159 3300009826 Ga0123355_10038761 Ga0123355_100387614 550
160 3300042594 Ga0466694_023612 Ga0466694_023612_5398_7050 550

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02614 UxaC Glucuronate isomerase 61 547 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.