Protein Family IF04962

Metagenome Isolate
120 Members
35 Samples
110 Scaffolds
282.57 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_007078|Ga0466694_007078_10614_11552
Length
305 aa
Sequence
LWISVRLQWFLALFLSYEGGKMKKLISGKVREVYDILSSSDDKLVIVTTDRISAFDVILSKLVKDKGKVLNAVSLFWFDFTKDIIPNHIISSDLKDMPEFFRKSEFEGRTVLVKKLKMLPFEFIVRGYMFGTMWNAYSKGEEFCGQKIEGDYKQAEKLAAPLFTPSTKAHTGHDEYISIKYLADTIGGELAKKIEKICFEIYNTCYNYAYNKNIIIADTKFEFGLDENNNLFLADEVLTPDSSRFWSLSDYQAGTSPKSYDKQFVRDWLLNNKKDGQMQFDNVPDDILNKTSDIYAECLRKLVNA

📊 Sample Types

Isolate 8.3%
Metagenome 91.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 36.4%
Termitidae 33.3%
Formicidae 12.1%
Rhinotermitidae 6.1%
Kalotermitidae 6.1%
Passalidae 3.0%
Termopsidae 3.0%

🌳 Taxonomy

Archaea 2
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
2 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
8 2772190998 Unclassified Bathyarchaeota Nc150P4bin1 Isolate Unclassified
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
12 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
13 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
18 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
19 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
30 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
31 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_398176 3300042656 Bacteria 2432
2 Ga0466707_277519 3300042601 Bacteria 2502
3 Ga0466720_117769 3300042607 Unclassified 2297
4 AustNasuHG_c1005096 3300000089 Bacteria 4699
5 AustNasuHG_c1005661 3300000089 Bacteria 4472
6 Ga0466704_094551 3300042643 Bacteria 3155
7 Ga0466699_134127 3300042597 Unclassified 1102
8 Ga0466699_255253 3300042597 Bacteria 8964
9 Ga0466718_000478 3300042617 Bacteria 1985
10 Ga0466718_034957 3300042617 Bacteria 3930
11 Ga0466718_120957 3300042617 Bacteria 20111
12 Ga0466698_452963 3300042610 Bacteria 1058
13 AustNasuHG_c1017962 3300000089 Bacteria 2340
14 JGI24695J34938_10006602 3300002450 Bacteria 6926
15 Ga0074263_111576 3300005485 Bacteria 1599
16 Ga0466702_244361 3300042635 Bacteria 5062
17 Ga0466704_440783 3300042643 Bacteria 4641
18 Ga0466727_001674 3300042655 Bacteria 26788
19 Ga0466694_244817 3300042594 Bacteria 21258
20 Ga0466699_154626 3300042597 Bacteria 2219
21 Ga0466699_160306 3300042597 Bacteria 14939
22 Ga0466699_256565 3300042597 Bacteria 1950
23 Ga0466718_034340 3300042617 Bacteria 1996
24 Ga0466720_020803 3300042607 Bacteria 5579
25 Ga0466720_066729 3300042607 Bacteria 10048
26 Ga0466720_112162 3300042607 Bacteria 1836
27 Ga0466720_171391 3300042607 Bacteria 8056
28 AustNasuHG_c1001742 3300000089 Bacteria 7867
29 JGI24695J34938_10021532 3300002450 Bacteria 3151
30 Ga0072941_1233634 3300005201 Bacteria 3115
31 Ga0074263_107779 3300005485 Bacteria 2773
32 Ga0074263_108470 3300005485 Bacteria 6240
33 Ga0466704_295958 3300042643 Bacteria 6529
34 Ga0264413_120098 3300024493 Bacteria 2222
35 Ga0466694_352061 3300042594 Bacteria 4721
36 Ga0466699_131531 3300042597 Bacteria 20480
37 Ga0466699_152157 3300042597 Unclassified 1004
38 Ga0466718_130509 3300042617 Bacteria 6822
39 Ga0466732_195138 3300042656 Bacteria 15041
40 Ga0466732_255003 3300042656 Archaea 12212
41 Ga0466732_379577 3300042656 Bacteria 21224
42 Ga0466707_022985 3300042601 Bacteria 35285
43 Ga0466720_018922 3300042607 Bacteria 1822
44 Ga0466720_031665 3300042607 Bacteria 3576
45 Ga0466720_130191 3300042607 Bacteria 3597
46 Ga0466722_257644 3300042609 Bacteria 49245
47 Ga0466698_087926 3300042610 Bacteria 1415
48 AustNasuHG_c1006232 3300000089 Bacteria 4261
49 Ga0466699_008755 3300042597 Bacteria 1541
50 Ga0466699_147286 3300042597 Bacteria 2183
51 Ga0466699_150208 3300042597 Bacteria 1837
52 Ga0466699_169300 3300042597 Bacteria 1034
53 Ga0466699_190241 3300042597 Bacteria 9619
54 Ga0466718_050586 3300042617 Bacteria 10484
55 Ga0466718_055454 3300042617 Bacteria 1422
56 Ga0466719_076092 3300042606 Bacteria 1865
57 Ga0466720_068653 3300042607 Bacteria 4107
58 Ga0466720_142302 3300042607 Bacteria 1394
59 IMNBL1DRAFT_c0003588 3300000062 Bacteria 9843
60 AustNasuHG_c1022899 3300000089 Bacteria 2001
61 Ga0074263_111705 3300005485 Bacteria 4126
62 Ga0103264_1000018 3300007188 Bacteria 128388
63 Ga0123353_10083741 3300010167 Bacteria 5133
64 Ga0466702_168211 3300042635 Bacteria 6442
65 Ga0466694_126938 3300042594 Bacteria 17529
66 Ga0466699_115075 3300042597 Bacteria 5036
67 Ga0466699_437116 3300042597 Bacteria 20035
68 Ga0466718_126141 3300042617 Bacteria 3659
69 Ga0466720_054175 3300042607 Bacteria 2159
70 Ga0466720_061122 3300042607 Bacteria 8477
71 AustNasuHG_c1000286 3300000089 Bacteria 17498
72 AustNasuHG_c1010392 3300000089 Bacteria 3244
73 Ga0074263_111125 3300005485 Bacteria 2628
74 Ga0466694_222943 3300042594 Bacteria 1401
75 Ga0466699_002401 3300042597 Bacteria 74503
76 Ga0466699_008728 3300042597 Bacteria 1131
77 Ga0466699_154965 3300042597 Bacteria 12710
78 Ga0466699_441266 3300042597 Bacteria 28353
79 Ga0466707_120335 3300042601 Bacteria 23353
80 Ga0466713_092919 3300042602 Bacteria 77366
81 Ga0466698_037473 3300042610 Bacteria 1454
82 AustNasuHG_c1018005 3300000089 Bacteria 2337
83 Ga0072941_1135479 3300005201 Bacteria 6313
84 Ga0074263_109979 3300005485 Bacteria 3977
85 Ga0102735_1000083 3300007080 Bacteria 25246
86 Ga0103267_1000013 3300007190 Bacteria 65512
87 Ga0103268_1000031 3300007192 Bacteria 45121
88 Ga0466702_101429 3300042635 Bacteria 1752
89 Ga0466699_012069 3300042597 Bacteria 1261
90 Ga0466699_380399 3300042597 Bacteria 3795
91 Ga0466718_121542 3300042617 Bacteria 3688
92 Ga0466720_012731 3300042607 Bacteria 38091
93 Ga0466720_116740 3300042607 Bacteria 72912
94 Ga0466720_121956 3300042607 Bacteria 8223
95 Ga0466720_147033 3300042607 Bacteria 48792
96 Ga0466698_464446 3300042610 Bacteria 1426
97 IMNBL1DRAFT_c0003288 3300000062 Bacteria 10520
98 Ga0074263_108134 3300005485 Bacteria 5918
99 Ga0074263_117392 3300005485 Bacteria 2703
100 Ga0466702_164877 3300042635 Bacteria 1393
101 Ga0466702_323122 3300042635 Bacteria 1789
102 Ga0264413_101684 3300024493 Bacteria 18599
103 Ga0466694_007078 3300042594 Bacteria 11801
104 Ga0466694_098932 3300042594 Unclassified 3162
105 Ga0466694_299537 3300042594 Bacteria 5778
106 Ga0466699_004283 3300042597 Bacteria 2692
107 Ga0466699_219759 3300042597 Bacteria 9600
108 Ga0466718_033383 3300042617 Bacteria 3930
109 Ga0466718_083344 3300042617 Bacteria 41687
110 Ga0466729_017964 3300042621 Bacteria 95785

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_152157 Ga0466699_152157_171_980 269
2 3300042610 Ga0466698_452963 Ga0466698_452963_93_935 271
3 3300042655 Ga0466727_001674 Ga0466727_001674_4179_5009 276
4 3300042601 Ga0466707_277519 Ga0466707_277519_679_1515 278
5 iso_pr_bacteria 2820272499 2820274635 279
6 iso_pr_bacteria 2820671341 2820673009 279
7 3300000062 IMNBL1DRAFT_c0003588 IMNBL1DRAFT_000358810 280
8 3300002450 JGI24695J34938_10006602 JGI24695J34938_100066025 280
9 3300042597 Ga0466699_002401 Ga0466699_002401_10319_11161 280
10 3300042597 Ga0466699_004283 Ga0466699_004283_415_1257 280
11 3300042597 Ga0466699_008728 Ga0466699_008728_229_1071 280
12 3300042597 Ga0466699_115075 Ga0466699_115075_1522_2364 280
13 3300042597 Ga0466699_131531 Ga0466699_131531_16666_17508 280
14 3300042597 Ga0466699_134127 Ga0466699_134127_235_1077 280
15 3300042597 Ga0466699_147286 Ga0466699_147286_409_1251 280
16 3300042597 Ga0466699_150208 Ga0466699_150208_108_950 280
17 3300042597 Ga0466699_154626 Ga0466699_154626_710_1552 280
18 3300042597 Ga0466699_154965 Ga0466699_154965_3455_4297 280
19 3300042597 Ga0466699_160306 Ga0466699_160306_623_1465 280
20 3300042597 Ga0466699_169300 Ga0466699_169300_163_1005 280
21 3300042597 Ga0466699_190241 Ga0466699_190241_7000_7842 280
22 3300042597 Ga0466699_219759 Ga0466699_219759_3454_4296 280
23 3300042597 Ga0466699_255253 Ga0466699_255253_6303_7145 280
24 3300042597 Ga0466699_256565 Ga0466699_256565_107_949 280
25 3300042597 Ga0466699_380399 Ga0466699_380399_2283_3125 280
26 3300042597 Ga0466699_437116 Ga0466699_437116_5674_6516 280
27 3300042597 Ga0466699_441266 Ga0466699_441266_13589_14431 280
28 3300042601 Ga0466707_120335 Ga0466707_120335_11260_12102 280
29 3300042607 Ga0466720_012731 Ga0466720_012731_11631_12473 280
30 3300042607 Ga0466720_018922 Ga0466720_018922_131_973 280
31 3300042607 Ga0466720_020803 Ga0466720_020803_4262_5104 280
32 3300042607 Ga0466720_061122 Ga0466720_061122_3062_3904 280
33 3300042607 Ga0466720_066729 Ga0466720_066729_5354_6196 280
34 3300042607 Ga0466720_112162 Ga0466720_112162_460_1302 280
35 3300042607 Ga0466720_116740 Ga0466720_116740_70120_70962 280
36 3300042607 Ga0466720_117769 Ga0466720_117769_909_1751 280
37 3300042607 Ga0466720_121956 Ga0466720_121956_2755_3597 280
38 3300042607 Ga0466720_147033 Ga0466720_147033_12748_13590 280
39 3300042610 Ga0466698_087926 Ga0466698_087926_101_943 280
40 3300042617 Ga0466718_055454 Ga0466718_055454_63_905 280
41 3300042617 Ga0466718_083344 Ga0466718_083344_16673_17515 280
42 3300042617 Ga0466718_120957 Ga0466718_120957_2625_3467 280
43 3300042617 Ga0466718_130509 Ga0466718_130509_2924_3766 280
44 3300042635 Ga0466702_101429 Ga0466702_101429_606_1448 280
45 3300042635 Ga0466702_323122 Ga0466702_323122_912_1754 280
46 3300042656 Ga0466732_195138 Ga0466732_195138_527_1369 280
47 3300042656 Ga0466732_255003 Ga0466732_255003_4319_5161 280
48 3300042656 Ga0466732_379577 Ga0466732_379577_2034_2876 280
49 3300042656 Ga0466732_398176 Ga0466732_398176_1289_2131 280
50 iso_pr_bacteria 2820234266 2820234934 280
51 iso_pr_bacteria 2820551407 2820552096 280
52 iso_pr_bacteria 2820702360 2820702829 280
53 3300000089 AustNasuHG_c1000286 AustNasuHG_10002863 281
54 3300000089 AustNasuHG_c1005661 AustNasuHG_10056612 281
55 3300000089 AustNasuHG_c1010392 AustNasuHG_10103923 281
56 3300005201 Ga0072941_1233634 Ga0072941_12336342 281
57 3300005485 Ga0074263_108470 Ga0074263_1084704 281
58 3300005485 Ga0074263_111705 Ga0074263_1117052 281
59 3300005485 Ga0074263_117392 Ga0074263_1173922 281
60 3300024493 Ga0264413_101684 Ga0264413_10168414 281
61 3300024493 Ga0264413_120098 Ga0264413_1200982 281
62 3300042594 Ga0466694_222943 Ga0466694_222943_356_1201 281
63 3300042594 Ga0466694_352061 Ga0466694_352061_3379_4224 281
64 3300042606 Ga0466719_076092 Ga0466719_076092_572_1417 281
65 3300042607 Ga0466720_031665 Ga0466720_031665_2504_3349 281
66 3300042617 Ga0466718_033383 Ga0466718_033383_1559_2404 281
67 3300042617 Ga0466718_034957 Ga0466718_034957_1559_2404 281
68 3300042617 Ga0466718_050586 Ga0466718_050586_6446_7291 281
69 3300042635 Ga0466702_164877 Ga0466702_164877_434_1279 281
70 iso_pr_bacteria 2820464928 2820466217 281
71 iso_pr_bacteria 2820683647 2820684398 281
72 iso_pu_archaea 2772190998 2773796099 281
73 3300000062 IMNBL1DRAFT_c0003288 IMNBL1DRAFT_00032883 282
74 3300000089 AustNasuHG_c1018005 AustNasuHG_10180052 282
75 3300005485 Ga0074263_107779 Ga0074263_1077792 282
76 3300005485 Ga0074263_109979 Ga0074263_1099792 282
77 3300042597 Ga0466699_012069 Ga0466699_012069_246_1094 282
78 3300042601 Ga0466707_022985 Ga0466707_022985_25674_26522 282
79 3300042602 Ga0466713_092919 Ga0466713_092919_33849_34697 282
80 3300042609 Ga0466722_257644 Ga0466722_257644_13348_14196 282
81 3300042617 Ga0466718_126141 Ga0466718_126141_1307_2155 282
82 3300042621 Ga0466729_017964 Ga0466729_017964_27464_28312 282
83 3300042617 Ga0466718_000478 Ga0466718_000478_609_1460 283
84 3300042643 Ga0466704_094551 Ga0466704_094551_1114_1965 283
85 3300042643 Ga0466704_295958 Ga0466704_295958_3428_4279 283
86 3300005201 Ga0072941_1135479 Ga0072941_11354796 284
87 3300042610 Ga0466698_464446 Ga0466698_464446_102_956 284
88 3300000089 AustNasuHG_c1005096 AustNasuHG_10050965 285
89 3300002450 JGI24695J34938_10021532 JGI24695J34938_100215322 285
90 3300042617 Ga0466718_121542 Ga0466718_121542_349_1206 285
91 3300042643 Ga0466704_440783 Ga0466704_440783_545_1402 285
92 iso_pr_bacteria 2820275298 2820275643 285
93 3300000089 AustNasuHG_c1017962 AustNasuHG_10179622 286
94 3300007190 Ga0103267_1000013 Ga0103267_10000132 286
95 3300007192 Ga0103268_1000031 Ga0103268_100003148 286
96 3300010167 Ga0123353_10083741 Ga0123353_100837412 286
97 3300042594 Ga0466694_299537 Ga0466694_299537_1209_2069 286
98 3300042607 Ga0466720_054175 Ga0466720_054175_892_1752 286
99 3300042607 Ga0466720_068653 Ga0466720_068653_321_1181 286
100 3300042617 Ga0466718_034340 Ga0466718_034340_655_1563 286
101 3300000089 AustNasuHG_c1006232 AustNasuHG_10062323 287
102 3300007080 Ga0102735_1000083 Ga0102735_100008323 287
103 3300007188 Ga0103264_1000018 Ga0103264_1000018106 287
104 3300042597 Ga0466699_008755 Ga0466699_008755_175_1038 287
105 3300042594 Ga0466694_244817 Ga0466694_244817_14244_15110 288
106 3300042607 Ga0466720_130191 Ga0466720_130191_2099_2965 288
107 3300042635 Ga0466702_244361 Ga0466702_244361_1158_2024 288
108 3300000089 AustNasuHG_c1001742 AustNasuHG_10017423 289
109 3300000089 AustNasuHG_c1022899 AustNasuHG_10228992 289
110 3300042607 Ga0466720_171391 Ga0466720_171391_4605_5474 289
111 3300005485 Ga0074263_108134 Ga0074263_1081343 290
112 3300005485 Ga0074263_111125 Ga0074263_1111252 290
113 3300005485 Ga0074263_111576 Ga0074263_1115762 290
114 3300042594 Ga0466694_098932 Ga0466694_098932_201_1073 290
115 3300042594 Ga0466694_126938 Ga0466694_126938_15106_15978 290
116 iso_pr_bacteria 2758568796 2761047285 290
117 3300042635 Ga0466702_168211 Ga0466702_168211_681_1556 291
118 3300042607 Ga0466720_142302 Ga0466720_142302_131_1018 295
119 3300042610 Ga0466698_037473 Ga0466698_037473_298_1191 297
120 3300042594 Ga0466694_007078 Ga0466694_007078_10614_11552 305

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01259 SAICAR_synt SAICAR synthetase 25 279 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.