Protein Family IF04953

Metagenome Isolate
105 Members
42 Samples
101 Scaffolds
322.06 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_216587|Ga0466691_216587_5153_6187
Length
344 aa
Sequence
MLHLLTSPRRKEAAMDFRMKLLRVVVMFLLFLTLRANAESFRTLVSGNAEISPDRPGGASLRLGINSAAAVSLGPETRFFRGIEMELSSPQDWLEYRGSLAVAIYVDLDRPPSTGAADMEGRRIVFEPLPGKLQSVYQIPVRPAHGLRTTPYVTVPAEIVPPSSFPILFRVMPVIKGMSEELETMIFQFTVRPILSDEGAVKLSPRFPGQLPEKPFAVLIDDVAVENLSEEQMLKEGEHHLVILSDDYRNESRRFVVERAKILNLIIDLKDSSPLIVFEGPANAAIFLDNVPVTRESGSIPTEPGVHEAKFQVGDYTVIKTLSVERGKTYRVSLEVDINVQESD

📊 Sample Types

Isolate 3.8%
Metagenome 96.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.0%
Kalotermitidae 34.1%
Unclassified 12.2%
Rhinotermitidae 7.3%
Termopsidae 7.3%

🌳 Taxonomy

Archaea 0
Bacteria 104
Eukaryota 0
Viruses 1
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
2 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
26 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
27 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_389407 3300042656 Bacteria 1791
2 Ga0466698_195146 3300042610 Bacteria 1936
3 Ga0466712_110665 3300042614 Bacteria 1591
4 Ga0456237_0002592 3300041968 Bacteria 2918
5 Ga0466690_209861 3300042590 Bacteria 11099
6 Ga0466703_005487 3300042636 Bacteria 3520
7 Ga0466703_135677 3300042636 Bacteria 2396
8 Ga0466704_017756 3300042643 Bacteria 15432
9 Ga0466704_136177 3300042643 Bacteria 10104
10 Ga0466708_006371 3300042652 Bacteria 1653
11 Ga0466705_251379 3300042612 Bacteria 36395
12 Ga0466732_234849 3300042656 Bacteria 1791
13 Ga0466707_151048 3300042601 Bacteria 2438
14 Ga0466722_217459 3300042609 Bacteria 3775
15 Ga0466715_584503 3300042616 Bacteria 12053
16 Ga0466728_087524 3300042620 Bacteria 6246
17 Ga0466728_149915 3300042620 Bacteria 1548
18 Ga0466699_016151 3300042597 Bacteria 11577
19 Ga0466699_248401 3300042597 Bacteria 1719
20 Ga0466709_162804 3300042648 Bacteria 11552
21 Ga0123354_10181966 3300010882 Bacteria 2395
22 JGI24698J34947_10002886 3300002449 Bacteria 9316
23 JGI24695J34938_10042838 3300002450 Bacteria 2023
24 Ga0466732_003313 3300042656 Bacteria 1237
25 Ga0466716_043464 3300042605 Bacteria 4352
26 Ga0466719_566878 3300042606 Bacteria 1732
27 Ga0466720_101362 3300042607 Bacteria 2108
28 Ga0466722_253167 3300042609 Bacteria 5595
29 Ga0466692_078847 3300042591 Bacteria 7398
30 Ga0466692_138029 3300042591 Bacteria 8108
31 Ga0466692_172973 3300042591 Bacteria 3996
32 Ga0466691_126229 3300042593 Bacteria 2568
33 Ga0466696_305521 3300042596 Bacteria 23613
34 Ga0466699_098685 3300042597 Viruses 3962
35 Ga0466705_111284 3300042612 Bacteria 9884
36 Ga0466720_110160 3300042607 Bacteria 10162
37 Ga0466722_070145 3300042609 Bacteria 18780
38 Ga0466722_225543 3300042609 Bacteria 16859
39 Ga0466726_379583 3300042619 Bacteria 1376
40 Ga0466692_188017 3300042591 Bacteria 2932
41 Ga0123355_10056323 3300009826 Bacteria 6362
42 Ga0123356_10689843 3300010049 Bacteria 1190
43 Ga0123353_10006942 3300010167 Bacteria 15221
44 Ga0123353_10594011 3300010167 Bacteria 1584
45 JGI24698J34947_10028255 3300002449 Bacteria 2971
46 Ga0466707_196546 3300042601 Bacteria 1813
47 Ga0466716_157808 3300042605 Bacteria 6837
48 Ga0466719_065528 3300042606 Bacteria 25048
49 Ga0466719_190434 3300042606 Bacteria 12066
50 Ga0466722_170802 3300042609 Bacteria 5550
51 Ga0466723_046786 3300042618 Bacteria 9463
52 Ga0466723_067599 3300042618 Bacteria 49452
53 Ga0466728_324119 3300042620 Bacteria 2156
54 Ga0466699_121874 3300042597 Bacteria 2171
55 Ga0466699_138931 3300042597 Bacteria 1669
56 Ga0466699_240754 3300042597 Bacteria 2037
57 Ga0466735_174443 3300042624 Bacteria 1340
58 Ga0466708_097627 3300042652 Bacteria 2279
59 Ga0466727_241303 3300042655 Bacteria 7263
60 Ga0123357_10009872 3300009784 Bacteria 12082
61 JGI24698J34947_10074982 3300002449 Bacteria 1610
62 JGI24695J34938_10005580 3300002450 Bacteria 7802
63 Ga0072940_1003452 3300005200 Bacteria 9649
64 Ga0466716_186794 3300042605 Bacteria 8560
65 Ga0466722_029635 3300042609 Bacteria 2340
66 Ga0466711_005217 3300042615 Bacteria 10528
67 Ga0466718_118514 3300042617 Bacteria 9397
68 Ga0466723_225659 3300042618 Bacteria 9074
69 Ga0264413_106087 3300024493 Bacteria 19557
70 Ga0466699_358234 3300042597 Bacteria 2571
71 Ga0466702_114456 3300042635 Bacteria 1402
72 Ga0466703_177192 3300042636 Bacteria 1501
73 Ga0123357_10160152 3300009784 Bacteria 2701
74 JGI24702J35022_10021304 3300002462 Bacteria 3516
75 Ga0466705_292652 3300042612 Bacteria 4538
76 Ga0466720_031739 3300042607 Bacteria 9560
77 Ga0466722_090953 3300042609 Bacteria 11554
78 Ga0466711_336320 3300042615 Bacteria 1423
79 Ga0466728_374336 3300042620 Bacteria 5948
80 Ga0264413_106088 3300024493 Bacteria 13365
81 Ga0456237_0006152 3300041968 Bacteria 1890
82 Ga0466690_003361 3300042590 Bacteria 10331
83 Ga0466691_216587 3300042593 Bacteria 8813
84 Ga0466699_142969 3300042597 Bacteria 1536
85 Ga0466699_153031 3300042597 Bacteria 1599
86 Ga0466699_228773 3300042597 Bacteria 36031
87 Ga0466699_379390 3300042597 Bacteria 1452
88 Ga0466703_301095 3300042636 Bacteria 13764
89 Ga0466727_241534 3300042655 Bacteria 2335
90 JGI24695J34938_10013691 3300002450 Bacteria 4247
91 JGI24702J35022_10014640 3300002462 Bacteria 4323
92 Ga0466720_055482 3300042607 Bacteria 13932
93 Ga0466723_024858 3300042618 Bacteria 9148
94 Ga0466728_022052 3300042620 Bacteria 3347
95 Ga0466692_186629 3300042591 Bacteria 1885
96 Ga0466699_061595 3300042597 Bacteria 10614
97 Ga0466735_003801 3300042624 Bacteria 14568
98 Ga0466735_047904 3300042624 Bacteria 11124
99 Ga0466704_213780 3300042643 Bacteria 47213
100 Ga0466708_240784 3300042652 Bacteria 13374
101 Ga0123353_10268166 3300010167 Bacteria 2632

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042635 Ga0466702_114456 Ga0466702_114456_31_873 280
2 3300042597 Ga0466699_142969 Ga0466699_142969_668_1516 282
3 3300042620 Ga0466728_149915 Ga0466728_149915_503_1363 286
4 3300042597 Ga0466699_016151 Ga0466699_016151_5695_6678 290
5 3300042618 Ga0466723_225659 Ga0466723_225659_4872_5750 292
6 3300042614 Ga0466712_110665 Ga0466712_110665_385_1368 295
7 3300002449 JGI24698J34947_10028255 JGI24698J34947_100282553 296
8 3300042607 Ga0466720_055482 Ga0466720_055482_5488_6423 297
9 3300042597 Ga0466699_138931 Ga0466699_138931_753_1658 301
10 3300042607 Ga0466720_031739 Ga0466720_031739_2139_3122 301
11 3300042607 Ga0466720_101362 Ga0466720_101362_971_1954 301
12 3300042624 Ga0466735_174443 Ga0466735_174443_21_926 301
13 3300024493 Ga0264413_106088 Ga0264413_10608812 303
14 3300042597 Ga0466699_121874 Ga0466699_121874_667_1602 311
15 3300042597 Ga0466699_153031 Ga0466699_153031_464_1399 311
16 3300042597 Ga0466699_228773 Ga0466699_228773_5394_6329 311
17 3300042601 Ga0466707_196546 Ga0466707_196546_427_1365 312
18 3300042636 Ga0466703_177192 Ga0466703_177192_75_1013 312
19 3300009784 Ga0123357_10009872 Ga0123357_100098728 313
20 3300042601 Ga0466707_151048 Ga0466707_151048_918_1865 315
21 3300042590 Ga0466690_003361 Ga0466690_003361_7865_8857 319
22 3300042609 Ga0466722_029635 Ga0466722_029635_202_1161 319
23 3300042618 Ga0466723_024858 Ga0466723_024858_389_1381 319
24 3300042590 Ga0466690_209861 Ga0466690_209861_3898_4863 321
25 3300009826 Ga0123355_10056323 Ga0123355_100563232 324
26 3300042597 Ga0466699_098685 Ga0466699_098685_2075_3049 324
27 3300042606 Ga0466719_566878 Ga0466719_566878_436_1410 324
28 3300042643 Ga0466704_136177 Ga0466704_136177_4112_5086 324
29 3300042597 Ga0466699_061595 Ga0466699_061595_8472_9449 325
30 3300042597 Ga0466699_248401 Ga0466699_248401_254_1258 325
31 3300042597 Ga0466699_358234 Ga0466699_358234_1179_2156 325
32 3300042605 Ga0466716_186794 Ga0466716_186794_5291_6268 325
33 3300002449 JGI24698J34947_10074982 JGI24698J34947_100749821 326
34 3300042591 Ga0466692_078847 Ga0466692_078847_1398_2405 326
35 3300042597 Ga0466699_379390 Ga0466699_379390_170_1150 326
36 3300042605 Ga0466716_043464 Ga0466716_043464_2093_3073 326
37 3300042606 Ga0466719_065528 Ga0466719_065528_9282_10262 326
38 3300042606 Ga0466719_190434 Ga0466719_190434_9537_10517 326
39 3300042609 Ga0466722_217459 Ga0466722_217459_1498_2478 326
40 3300042609 Ga0466722_253167 Ga0466722_253167_3757_4737 326
41 3300042612 Ga0466705_111284 Ga0466705_111284_7545_8525 326
42 3300042612 Ga0466705_292652 Ga0466705_292652_1645_2625 326
43 3300042617 Ga0466718_118514 Ga0466718_118514_7797_8777 326
44 3300042618 Ga0466723_046786 Ga0466723_046786_1990_2970 326
45 3300042618 Ga0466723_067599 Ga0466723_067599_8681_9661 326
46 3300042619 Ga0466726_379583 Ga0466726_379583_326_1306 326
47 3300042620 Ga0466728_022052 Ga0466728_022052_1696_2676 326
48 3300042620 Ga0466728_087524 Ga0466728_087524_683_1663 326
49 3300042620 Ga0466728_374336 Ga0466728_374336_1792_2772 326
50 3300042624 Ga0466735_003801 Ga0466735_003801_5200_6180 326
51 3300042636 Ga0466703_135677 Ga0466703_135677_999_1979 326
52 3300042636 Ga0466703_301095 Ga0466703_301095_10963_11943 326
53 3300042643 Ga0466704_017756 Ga0466704_017756_5398_6378 326
54 3300042648 Ga0466709_162804 Ga0466709_162804_5800_6780 326
55 3300042652 Ga0466708_240784 Ga0466708_240784_6350_7330 326
56 3300042655 Ga0466727_241534 Ga0466727_241534_1124_2104 326
57 iso_pr_bacteria 2781125631 2781268181 326
58 3300009784 Ga0123357_10160152 Ga0123357_101601522 327
59 3300010049 Ga0123356_10689843 Ga0123356_106898431 327
60 3300010167 Ga0123353_10594011 Ga0123353_105940112 327
61 3300024493 Ga0264413_106087 Ga0264413_1060879 327
62 3300042591 Ga0466692_138029 Ga0466692_138029_6142_7125 327
63 3300042591 Ga0466692_172973 Ga0466692_172973_238_1221 327
64 3300042597 Ga0466699_240754 Ga0466699_240754_634_1617 327
65 3300042607 Ga0466720_110160 Ga0466720_110160_3675_4658 327
66 3300042609 Ga0466722_070145 Ga0466722_070145_1920_2903 327
67 3300042609 Ga0466722_170802 Ga0466722_170802_770_1753 327
68 3300042609 Ga0466722_225543 Ga0466722_225543_231_1214 327
69 3300042610 Ga0466698_195146 Ga0466698_195146_763_1746 327
70 3300042612 Ga0466705_251379 Ga0466705_251379_29371_30354 327
71 3300042643 Ga0466704_213780 Ga0466704_213780_21125_22108 327
72 3300042656 Ga0466732_003313 Ga0466732_003313_151_1134 327
73 3300042656 Ga0466732_234849 Ga0466732_234849_733_1716 327
74 iso_pr_bacteria 2781125693 2781434958 327
75 iso_pr_bacteria 2781125695 2781439434 327
76 iso_pr_bacteria 2781125696 2781441247 327
77 3300002449 JGI24698J34947_10002886 JGI24698J34947_100028863 328
78 3300002450 JGI24695J34938_10013691 JGI24695J34938_100136912 328
79 3300002450 JGI24695J34938_10042838 JGI24695J34938_100428382 328
80 3300002462 JGI24702J35022_10014640 JGI24702J35022_100146402 328
81 3300002462 JGI24702J35022_10021304 JGI24702J35022_100213045 328
82 3300005200 Ga0072940_1003452 Ga0072940_10034525 328
83 3300010167 Ga0123353_10006942 Ga0123353_100069426 328
84 3300010167 Ga0123353_10268166 Ga0123353_102681662 328
85 3300010882 Ga0123354_10181966 Ga0123354_101819662 328
86 3300041968 Ga0456237_0006152 Ga0456237_0006152_810_1796 328
87 3300042591 Ga0466692_188017 Ga0466692_188017_379_1404 328
88 3300042605 Ga0466716_157808 Ga0466716_157808_169_1155 328
89 3300042624 Ga0466735_047904 Ga0466735_047904_4100_5086 328
90 3300042656 Ga0466732_389407 Ga0466732_389407_107_1093 328
91 3300041968 Ga0456237_0002592 Ga0456237_0002592_1453_2442 329
92 3300002450 JGI24695J34938_10005580 JGI24695J34938_100055804 330
93 3300042596 Ga0466696_305521 Ga0466696_305521_2992_3984 330
94 3300042609 Ga0466722_090953 Ga0466722_090953_2496_3488 330
95 3300042615 Ga0466711_005217 Ga0466711_005217_1164_2156 330
96 3300042615 Ga0466711_336320 Ga0466711_336320_214_1206 330
97 3300042616 Ga0466715_584503 Ga0466715_584503_9724_10716 330
98 3300042620 Ga0466728_324119 Ga0466728_324119_379_1371 330
99 3300042636 Ga0466703_005487 Ga0466703_005487_1744_2736 330
100 3300042652 Ga0466708_006371 Ga0466708_006371_426_1418 330
101 3300042655 Ga0466727_241303 Ga0466727_241303_2637_3629 330
102 3300042591 Ga0466692_186629 Ga0466692_186629_177_1175 332
103 3300042593 Ga0466691_126229 Ga0466691_126229_1519_2526 335
104 3300042652 Ga0466708_097627 Ga0466708_097627_903_1916 337
105 3300042593 Ga0466691_216587 Ga0466691_216587_5153_6187 344

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.