Protein Family IF04953
Metagenome
Isolate
105
Members
42
Samples
101
Scaffolds
322.06
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_216587|Ga0466691_216587_5153_6187
- Length
- 344 aa
- Sequence
- MLHLLTSPRRKEAAMDFRMKLLRVVVMFLLFLTLRANAESFRTLVSGNAEISPDRPGGASLRLGINSAAAVSLGPETRFFRGIEMELSSPQDWLEYRGSLAVAIYVDLDRPPSTGAADMEGRRIVFEPLPGKLQSVYQIPVRPAHGLRTTPYVTVPAEIVPPSSFPILFRVMPVIKGMSEELETMIFQFTVRPILSDEGAVKLSPRFPGQLPEKPFAVLIDDVAVENLSEEQMLKEGEHHLVILSDDYRNESRRFVVERAKILNLIIDLKDSSPLIVFEGPANAAIFLDNVPVTRESGSIPTEPGVHEAKFQVGDYTVIKTLSVERGKTYRVSLEVDINVQESD
Sample Types
Isolate
3.8%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.0%
Kalotermitidae
34.1%
Unclassified
12.2%
Rhinotermitidae
7.3%
Termopsidae
7.3%
Taxonomy
Archaea
0
Bacteria
104
Eukaryota
0
Viruses
1
Unclassified
0
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_389407 | 3300042656 | Bacteria | 1791 |
| 2 | Ga0466698_195146 | 3300042610 | Bacteria | 1936 |
| 3 | Ga0466712_110665 | 3300042614 | Bacteria | 1591 |
| 4 | Ga0456237_0002592 | 3300041968 | Bacteria | 2918 |
| 5 | Ga0466690_209861 | 3300042590 | Bacteria | 11099 |
| 6 | Ga0466703_005487 | 3300042636 | Bacteria | 3520 |
| 7 | Ga0466703_135677 | 3300042636 | Bacteria | 2396 |
| 8 | Ga0466704_017756 | 3300042643 | Bacteria | 15432 |
| 9 | Ga0466704_136177 | 3300042643 | Bacteria | 10104 |
| 10 | Ga0466708_006371 | 3300042652 | Bacteria | 1653 |
| 11 | Ga0466705_251379 | 3300042612 | Bacteria | 36395 |
| 12 | Ga0466732_234849 | 3300042656 | Bacteria | 1791 |
| 13 | Ga0466707_151048 | 3300042601 | Bacteria | 2438 |
| 14 | Ga0466722_217459 | 3300042609 | Bacteria | 3775 |
| 15 | Ga0466715_584503 | 3300042616 | Bacteria | 12053 |
| 16 | Ga0466728_087524 | 3300042620 | Bacteria | 6246 |
| 17 | Ga0466728_149915 | 3300042620 | Bacteria | 1548 |
| 18 | Ga0466699_016151 | 3300042597 | Bacteria | 11577 |
| 19 | Ga0466699_248401 | 3300042597 | Bacteria | 1719 |
| 20 | Ga0466709_162804 | 3300042648 | Bacteria | 11552 |
| 21 | Ga0123354_10181966 | 3300010882 | Bacteria | 2395 |
| 22 | JGI24698J34947_10002886 | 3300002449 | Bacteria | 9316 |
| 23 | JGI24695J34938_10042838 | 3300002450 | Bacteria | 2023 |
| 24 | Ga0466732_003313 | 3300042656 | Bacteria | 1237 |
| 25 | Ga0466716_043464 | 3300042605 | Bacteria | 4352 |
| 26 | Ga0466719_566878 | 3300042606 | Bacteria | 1732 |
| 27 | Ga0466720_101362 | 3300042607 | Bacteria | 2108 |
| 28 | Ga0466722_253167 | 3300042609 | Bacteria | 5595 |
| 29 | Ga0466692_078847 | 3300042591 | Bacteria | 7398 |
| 30 | Ga0466692_138029 | 3300042591 | Bacteria | 8108 |
| 31 | Ga0466692_172973 | 3300042591 | Bacteria | 3996 |
| 32 | Ga0466691_126229 | 3300042593 | Bacteria | 2568 |
| 33 | Ga0466696_305521 | 3300042596 | Bacteria | 23613 |
| 34 | Ga0466699_098685 | 3300042597 | Viruses | 3962 |
| 35 | Ga0466705_111284 | 3300042612 | Bacteria | 9884 |
| 36 | Ga0466720_110160 | 3300042607 | Bacteria | 10162 |
| 37 | Ga0466722_070145 | 3300042609 | Bacteria | 18780 |
| 38 | Ga0466722_225543 | 3300042609 | Bacteria | 16859 |
| 39 | Ga0466726_379583 | 3300042619 | Bacteria | 1376 |
| 40 | Ga0466692_188017 | 3300042591 | Bacteria | 2932 |
| 41 | Ga0123355_10056323 | 3300009826 | Bacteria | 6362 |
| 42 | Ga0123356_10689843 | 3300010049 | Bacteria | 1190 |
| 43 | Ga0123353_10006942 | 3300010167 | Bacteria | 15221 |
| 44 | Ga0123353_10594011 | 3300010167 | Bacteria | 1584 |
| 45 | JGI24698J34947_10028255 | 3300002449 | Bacteria | 2971 |
| 46 | Ga0466707_196546 | 3300042601 | Bacteria | 1813 |
| 47 | Ga0466716_157808 | 3300042605 | Bacteria | 6837 |
| 48 | Ga0466719_065528 | 3300042606 | Bacteria | 25048 |
| 49 | Ga0466719_190434 | 3300042606 | Bacteria | 12066 |
| 50 | Ga0466722_170802 | 3300042609 | Bacteria | 5550 |
| 51 | Ga0466723_046786 | 3300042618 | Bacteria | 9463 |
| 52 | Ga0466723_067599 | 3300042618 | Bacteria | 49452 |
| 53 | Ga0466728_324119 | 3300042620 | Bacteria | 2156 |
| 54 | Ga0466699_121874 | 3300042597 | Bacteria | 2171 |
| 55 | Ga0466699_138931 | 3300042597 | Bacteria | 1669 |
| 56 | Ga0466699_240754 | 3300042597 | Bacteria | 2037 |
| 57 | Ga0466735_174443 | 3300042624 | Bacteria | 1340 |
| 58 | Ga0466708_097627 | 3300042652 | Bacteria | 2279 |
| 59 | Ga0466727_241303 | 3300042655 | Bacteria | 7263 |
| 60 | Ga0123357_10009872 | 3300009784 | Bacteria | 12082 |
| 61 | JGI24698J34947_10074982 | 3300002449 | Bacteria | 1610 |
| 62 | JGI24695J34938_10005580 | 3300002450 | Bacteria | 7802 |
| 63 | Ga0072940_1003452 | 3300005200 | Bacteria | 9649 |
| 64 | Ga0466716_186794 | 3300042605 | Bacteria | 8560 |
| 65 | Ga0466722_029635 | 3300042609 | Bacteria | 2340 |
| 66 | Ga0466711_005217 | 3300042615 | Bacteria | 10528 |
| 67 | Ga0466718_118514 | 3300042617 | Bacteria | 9397 |
| 68 | Ga0466723_225659 | 3300042618 | Bacteria | 9074 |
| 69 | Ga0264413_106087 | 3300024493 | Bacteria | 19557 |
| 70 | Ga0466699_358234 | 3300042597 | Bacteria | 2571 |
| 71 | Ga0466702_114456 | 3300042635 | Bacteria | 1402 |
| 72 | Ga0466703_177192 | 3300042636 | Bacteria | 1501 |
| 73 | Ga0123357_10160152 | 3300009784 | Bacteria | 2701 |
| 74 | JGI24702J35022_10021304 | 3300002462 | Bacteria | 3516 |
| 75 | Ga0466705_292652 | 3300042612 | Bacteria | 4538 |
| 76 | Ga0466720_031739 | 3300042607 | Bacteria | 9560 |
| 77 | Ga0466722_090953 | 3300042609 | Bacteria | 11554 |
| 78 | Ga0466711_336320 | 3300042615 | Bacteria | 1423 |
| 79 | Ga0466728_374336 | 3300042620 | Bacteria | 5948 |
| 80 | Ga0264413_106088 | 3300024493 | Bacteria | 13365 |
| 81 | Ga0456237_0006152 | 3300041968 | Bacteria | 1890 |
| 82 | Ga0466690_003361 | 3300042590 | Bacteria | 10331 |
| 83 | Ga0466691_216587 | 3300042593 | Bacteria | 8813 |
| 84 | Ga0466699_142969 | 3300042597 | Bacteria | 1536 |
| 85 | Ga0466699_153031 | 3300042597 | Bacteria | 1599 |
| 86 | Ga0466699_228773 | 3300042597 | Bacteria | 36031 |
| 87 | Ga0466699_379390 | 3300042597 | Bacteria | 1452 |
| 88 | Ga0466703_301095 | 3300042636 | Bacteria | 13764 |
| 89 | Ga0466727_241534 | 3300042655 | Bacteria | 2335 |
| 90 | JGI24695J34938_10013691 | 3300002450 | Bacteria | 4247 |
| 91 | JGI24702J35022_10014640 | 3300002462 | Bacteria | 4323 |
| 92 | Ga0466720_055482 | 3300042607 | Bacteria | 13932 |
| 93 | Ga0466723_024858 | 3300042618 | Bacteria | 9148 |
| 94 | Ga0466728_022052 | 3300042620 | Bacteria | 3347 |
| 95 | Ga0466692_186629 | 3300042591 | Bacteria | 1885 |
| 96 | Ga0466699_061595 | 3300042597 | Bacteria | 10614 |
| 97 | Ga0466735_003801 | 3300042624 | Bacteria | 14568 |
| 98 | Ga0466735_047904 | 3300042624 | Bacteria | 11124 |
| 99 | Ga0466704_213780 | 3300042643 | Bacteria | 47213 |
| 100 | Ga0466708_240784 | 3300042652 | Bacteria | 13374 |
| 101 | Ga0123353_10268166 | 3300010167 | Bacteria | 2632 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042635 | Ga0466702_114456 | Ga0466702_114456_31_873 | 280 |
| 2 | 3300042597 | Ga0466699_142969 | Ga0466699_142969_668_1516 | 282 |
| 3 | 3300042620 | Ga0466728_149915 | Ga0466728_149915_503_1363 | 286 |
| 4 | 3300042597 | Ga0466699_016151 | Ga0466699_016151_5695_6678 | 290 |
| 5 | 3300042618 | Ga0466723_225659 | Ga0466723_225659_4872_5750 | 292 |
| 6 | 3300042614 | Ga0466712_110665 | Ga0466712_110665_385_1368 | 295 |
| 7 | 3300002449 | JGI24698J34947_10028255 | JGI24698J34947_100282553 | 296 |
| 8 | 3300042607 | Ga0466720_055482 | Ga0466720_055482_5488_6423 | 297 |
| 9 | 3300042597 | Ga0466699_138931 | Ga0466699_138931_753_1658 | 301 |
| 10 | 3300042607 | Ga0466720_031739 | Ga0466720_031739_2139_3122 | 301 |
| 11 | 3300042607 | Ga0466720_101362 | Ga0466720_101362_971_1954 | 301 |
| 12 | 3300042624 | Ga0466735_174443 | Ga0466735_174443_21_926 | 301 |
| 13 | 3300024493 | Ga0264413_106088 | Ga0264413_10608812 | 303 |
| 14 | 3300042597 | Ga0466699_121874 | Ga0466699_121874_667_1602 | 311 |
| 15 | 3300042597 | Ga0466699_153031 | Ga0466699_153031_464_1399 | 311 |
| 16 | 3300042597 | Ga0466699_228773 | Ga0466699_228773_5394_6329 | 311 |
| 17 | 3300042601 | Ga0466707_196546 | Ga0466707_196546_427_1365 | 312 |
| 18 | 3300042636 | Ga0466703_177192 | Ga0466703_177192_75_1013 | 312 |
| 19 | 3300009784 | Ga0123357_10009872 | Ga0123357_100098728 | 313 |
| 20 | 3300042601 | Ga0466707_151048 | Ga0466707_151048_918_1865 | 315 |
| 21 | 3300042590 | Ga0466690_003361 | Ga0466690_003361_7865_8857 | 319 |
| 22 | 3300042609 | Ga0466722_029635 | Ga0466722_029635_202_1161 | 319 |
| 23 | 3300042618 | Ga0466723_024858 | Ga0466723_024858_389_1381 | 319 |
| 24 | 3300042590 | Ga0466690_209861 | Ga0466690_209861_3898_4863 | 321 |
| 25 | 3300009826 | Ga0123355_10056323 | Ga0123355_100563232 | 324 |
| 26 | 3300042597 | Ga0466699_098685 | Ga0466699_098685_2075_3049 | 324 |
| 27 | 3300042606 | Ga0466719_566878 | Ga0466719_566878_436_1410 | 324 |
| 28 | 3300042643 | Ga0466704_136177 | Ga0466704_136177_4112_5086 | 324 |
| 29 | 3300042597 | Ga0466699_061595 | Ga0466699_061595_8472_9449 | 325 |
| 30 | 3300042597 | Ga0466699_248401 | Ga0466699_248401_254_1258 | 325 |
| 31 | 3300042597 | Ga0466699_358234 | Ga0466699_358234_1179_2156 | 325 |
| 32 | 3300042605 | Ga0466716_186794 | Ga0466716_186794_5291_6268 | 325 |
| 33 | 3300002449 | JGI24698J34947_10074982 | JGI24698J34947_100749821 | 326 |
| 34 | 3300042591 | Ga0466692_078847 | Ga0466692_078847_1398_2405 | 326 |
| 35 | 3300042597 | Ga0466699_379390 | Ga0466699_379390_170_1150 | 326 |
| 36 | 3300042605 | Ga0466716_043464 | Ga0466716_043464_2093_3073 | 326 |
| 37 | 3300042606 | Ga0466719_065528 | Ga0466719_065528_9282_10262 | 326 |
| 38 | 3300042606 | Ga0466719_190434 | Ga0466719_190434_9537_10517 | 326 |
| 39 | 3300042609 | Ga0466722_217459 | Ga0466722_217459_1498_2478 | 326 |
| 40 | 3300042609 | Ga0466722_253167 | Ga0466722_253167_3757_4737 | 326 |
| 41 | 3300042612 | Ga0466705_111284 | Ga0466705_111284_7545_8525 | 326 |
| 42 | 3300042612 | Ga0466705_292652 | Ga0466705_292652_1645_2625 | 326 |
| 43 | 3300042617 | Ga0466718_118514 | Ga0466718_118514_7797_8777 | 326 |
| 44 | 3300042618 | Ga0466723_046786 | Ga0466723_046786_1990_2970 | 326 |
| 45 | 3300042618 | Ga0466723_067599 | Ga0466723_067599_8681_9661 | 326 |
| 46 | 3300042619 | Ga0466726_379583 | Ga0466726_379583_326_1306 | 326 |
| 47 | 3300042620 | Ga0466728_022052 | Ga0466728_022052_1696_2676 | 326 |
| 48 | 3300042620 | Ga0466728_087524 | Ga0466728_087524_683_1663 | 326 |
| 49 | 3300042620 | Ga0466728_374336 | Ga0466728_374336_1792_2772 | 326 |
| 50 | 3300042624 | Ga0466735_003801 | Ga0466735_003801_5200_6180 | 326 |
| 51 | 3300042636 | Ga0466703_135677 | Ga0466703_135677_999_1979 | 326 |
| 52 | 3300042636 | Ga0466703_301095 | Ga0466703_301095_10963_11943 | 326 |
| 53 | 3300042643 | Ga0466704_017756 | Ga0466704_017756_5398_6378 | 326 |
| 54 | 3300042648 | Ga0466709_162804 | Ga0466709_162804_5800_6780 | 326 |
| 55 | 3300042652 | Ga0466708_240784 | Ga0466708_240784_6350_7330 | 326 |
| 56 | 3300042655 | Ga0466727_241534 | Ga0466727_241534_1124_2104 | 326 |
| 57 | iso_pr_bacteria | 2781125631 | 2781268181 | 326 |
| 58 | 3300009784 | Ga0123357_10160152 | Ga0123357_101601522 | 327 |
| 59 | 3300010049 | Ga0123356_10689843 | Ga0123356_106898431 | 327 |
| 60 | 3300010167 | Ga0123353_10594011 | Ga0123353_105940112 | 327 |
| 61 | 3300024493 | Ga0264413_106087 | Ga0264413_1060879 | 327 |
| 62 | 3300042591 | Ga0466692_138029 | Ga0466692_138029_6142_7125 | 327 |
| 63 | 3300042591 | Ga0466692_172973 | Ga0466692_172973_238_1221 | 327 |
| 64 | 3300042597 | Ga0466699_240754 | Ga0466699_240754_634_1617 | 327 |
| 65 | 3300042607 | Ga0466720_110160 | Ga0466720_110160_3675_4658 | 327 |
| 66 | 3300042609 | Ga0466722_070145 | Ga0466722_070145_1920_2903 | 327 |
| 67 | 3300042609 | Ga0466722_170802 | Ga0466722_170802_770_1753 | 327 |
| 68 | 3300042609 | Ga0466722_225543 | Ga0466722_225543_231_1214 | 327 |
| 69 | 3300042610 | Ga0466698_195146 | Ga0466698_195146_763_1746 | 327 |
| 70 | 3300042612 | Ga0466705_251379 | Ga0466705_251379_29371_30354 | 327 |
| 71 | 3300042643 | Ga0466704_213780 | Ga0466704_213780_21125_22108 | 327 |
| 72 | 3300042656 | Ga0466732_003313 | Ga0466732_003313_151_1134 | 327 |
| 73 | 3300042656 | Ga0466732_234849 | Ga0466732_234849_733_1716 | 327 |
| 74 | iso_pr_bacteria | 2781125693 | 2781434958 | 327 |
| 75 | iso_pr_bacteria | 2781125695 | 2781439434 | 327 |
| 76 | iso_pr_bacteria | 2781125696 | 2781441247 | 327 |
| 77 | 3300002449 | JGI24698J34947_10002886 | JGI24698J34947_100028863 | 328 |
| 78 | 3300002450 | JGI24695J34938_10013691 | JGI24695J34938_100136912 | 328 |
| 79 | 3300002450 | JGI24695J34938_10042838 | JGI24695J34938_100428382 | 328 |
| 80 | 3300002462 | JGI24702J35022_10014640 | JGI24702J35022_100146402 | 328 |
| 81 | 3300002462 | JGI24702J35022_10021304 | JGI24702J35022_100213045 | 328 |
| 82 | 3300005200 | Ga0072940_1003452 | Ga0072940_10034525 | 328 |
| 83 | 3300010167 | Ga0123353_10006942 | Ga0123353_100069426 | 328 |
| 84 | 3300010167 | Ga0123353_10268166 | Ga0123353_102681662 | 328 |
| 85 | 3300010882 | Ga0123354_10181966 | Ga0123354_101819662 | 328 |
| 86 | 3300041968 | Ga0456237_0006152 | Ga0456237_0006152_810_1796 | 328 |
| 87 | 3300042591 | Ga0466692_188017 | Ga0466692_188017_379_1404 | 328 |
| 88 | 3300042605 | Ga0466716_157808 | Ga0466716_157808_169_1155 | 328 |
| 89 | 3300042624 | Ga0466735_047904 | Ga0466735_047904_4100_5086 | 328 |
| 90 | 3300042656 | Ga0466732_389407 | Ga0466732_389407_107_1093 | 328 |
| 91 | 3300041968 | Ga0456237_0002592 | Ga0456237_0002592_1453_2442 | 329 |
| 92 | 3300002450 | JGI24695J34938_10005580 | JGI24695J34938_100055804 | 330 |
| 93 | 3300042596 | Ga0466696_305521 | Ga0466696_305521_2992_3984 | 330 |
| 94 | 3300042609 | Ga0466722_090953 | Ga0466722_090953_2496_3488 | 330 |
| 95 | 3300042615 | Ga0466711_005217 | Ga0466711_005217_1164_2156 | 330 |
| 96 | 3300042615 | Ga0466711_336320 | Ga0466711_336320_214_1206 | 330 |
| 97 | 3300042616 | Ga0466715_584503 | Ga0466715_584503_9724_10716 | 330 |
| 98 | 3300042620 | Ga0466728_324119 | Ga0466728_324119_379_1371 | 330 |
| 99 | 3300042636 | Ga0466703_005487 | Ga0466703_005487_1744_2736 | 330 |
| 100 | 3300042652 | Ga0466708_006371 | Ga0466708_006371_426_1418 | 330 |
| 101 | 3300042655 | Ga0466727_241303 | Ga0466727_241303_2637_3629 | 330 |
| 102 | 3300042591 | Ga0466692_186629 | Ga0466692_186629_177_1175 | 332 |
| 103 | 3300042593 | Ga0466691_126229 | Ga0466691_126229_1519_2526 | 335 |
| 104 | 3300042652 | Ga0466708_097627 | Ga0466708_097627_903_1916 | 337 |
| 105 | 3300042593 | Ga0466691_216587 | Ga0466691_216587_5153_6187 | 344 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.73 | 0.79 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.