Protein Family IF04951

Metagenome Isolate
142 Members
45 Samples
136 Scaffolds
335.9 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_214743|Ga0466691_214743_6364_7518
Length
365 aa
Sequence
MHRRYGTIAQPENNNYICTQIILTEIMKDNYCVIMGGGIGSRFWPFSRETRPKQFLDFFGTGRSLLQQTFDRFAQIVPSENIYIATNRKYADLVRQQLPDISDNQMLLEPTRRNTAPCIAYAAYRIRSINPNANMVVTPADHLILQEQNFLKNIQTGLNFAGKFPSLLTLGVKPNRPETGYGYIQTEEGGNDNIQKVKAFTEKPNYELATVFILNAFHTHLPDMTTRFDQGMGKFNTPAEAAFIEEQYPMCQNISIDYGIMEKDDNVYMLMADFGWSDLGTWGSLYDLAGKDDHLNATLKGKTLFIGSANNLVTLPDEKLAVIQGLDDYIIAESDDILLICKKSDEQRIKQFVADVNMRFGAKYL

📊 Sample Types

Isolate 4.2%
Metagenome 95.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 32.6%
Termitidae 23.3%
Unclassified 16.3%
Rhinotermitidae 9.3%
Termopsidae 7.0%
Passalidae 4.7%
Hodotermitidae 2.3%
Blattidae 2.3%
Aphididae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
2 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
3 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
4 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
5 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
6 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
7 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
8 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
9 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
10 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
11 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
22 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
23 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
24 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
31 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
32 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
35 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
40 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
41 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
42 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
43 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
44 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
45 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_072950 3300042624 Bacteria 3165
2 Ga0466735_076874 3300042624 Bacteria 3083
3 Ga0466735_094109 3300042624 Unclassified 1963
4 Ga0466735_107743 3300042624 Bacteria 2243
5 Ga0466735_116092 3300042624 Bacteria 5858
6 Ga0466703_223669 3300042636 Bacteria 3492
7 Ga0466704_106682 3300042643 Bacteria 6932
8 Ga0466704_157477 3300042643 Bacteria 12306
9 Ga0466704_307178 3300042643 Bacteria 2486
10 Ga0123354_10000260 3300010882 Bacteria 47442
11 Ga0123354_10009913 3300010882 Bacteria 14642
12 Ga0123354_10020243 3300010882 Bacteria 10459
13 Ga0466711_505356 3300042615 Bacteria 1348
14 Ga0466715_000756 3300042616 Bacteria 5724
15 Ga0466715_031489 3300042616 Bacteria 6628
16 Ga0466715_474042 3300042616 Bacteria 5704
17 Ga0466726_481576 3300042619 Bacteria 1585
18 Ga0466690_394866 3300042590 Bacteria 116329
19 Ga0466692_149013 3300042591 Bacteria 10943
20 Ga0466692_190201 3300042591 Bacteria 2034
21 Ga0466700_346378 3300042600 Bacteria 1787
22 Ga0466707_119043 3300042601 Bacteria 2252
23 2227632958 2225789004 Bacteria 11294
24 JGI24702J35022_10039936 3300002462 Unclassified 2503
25 Ga0466705_267581 3300042612 Bacteria 2036
26 Ga0466703_356236 3300042636 Bacteria 12720
27 Ga0123357_10018086 3300009784 Unclassified 9362
28 Ga0123357_10068138 3300009784 Bacteria 4737
29 Ga0123354_10255307 3300010882 Bacteria 1765
30 Ga0466705_440502 3300042612 Unclassified 7032
31 Ga0466726_301924 3300042619 Bacteria 5230
32 Ga0466729_041176 3300042621 Bacteria 7040
33 Ga0466701_032214 3300042598 Bacteria 43207
34 Ga0466706_289041 3300042599 Bacteria 4711
35 Ga0466713_116549 3300042602 Bacteria 10689
36 Ga0466722_205158 3300042609 Bacteria 23241
37 2227266903 2225789004 Bacteria 6952
38 JGI24699J35502_11134035 3300002509 Bacteria 25887
39 Ga0123357_10000491 3300009784 Bacteria 38307
40 Ga0466705_072196 3300042612 Bacteria 3435
41 Ga0466735_038091 3300042624 Bacteria 4511
42 Ga0466703_364164 3300042636 Bacteria 2677
43 Ga0466704_135353 3300042643 Bacteria 1736
44 Ga0466709_165812 3300042648 Bacteria 4283
45 Ga0123357_10027121 3300009784 Unclassified 7739
46 Ga0123354_10006316 3300010882 Bacteria 17574
47 Ga0123354_10161851 3300010882 Bacteria 2652
48 Ga0466711_147763 3300042615 Bacteria 12121
49 Ga0466726_040298 3300042619 Bacteria 11019
50 Ga0466726_252612 3300042619 Bacteria 3342
51 Ga0466728_061783 3300042620 Bacteria 5508
52 Ga0466692_030541 3300042591 Bacteria 59720
53 Ga0466691_214743 3300042593 Bacteria 11007
54 Ga0466696_088985 3300042596 Bacteria 12095
55 Ga0466707_054387 3300042601 Bacteria 59888
56 Ga0466707_286082 3300042601 Bacteria 3397
57 Ga0466707_287996 3300042601 Bacteria 10549
58 IMNBL1DRAFT_c0003894 3300000062 Bacteria 9263
59 Ga0068305_10047177 3300005083 Bacteria 7475
60 Ga0466703_248560 3300042636 Bacteria 44932
61 Ga0123356_10328628 3300010049 Bacteria 1645
62 Ga0466710_345832 3300042613 Bacteria 1465
63 Ga0466711_090299 3300042615 Bacteria 47995
64 Ga0466715_586319 3300042616 Bacteria 4408
65 Ga0466726_290438 3300042619 Bacteria 8355
66 Ga0466696_067335 3300042596 Bacteria 7101
67 Ga0466700_021305 3300042600 Bacteria 30578
68 Ga0466700_257713 3300042600 Bacteria 15144
69 Ga0466707_033660 3300042601 Bacteria 25263
70 Ga0127649_100123 3300009460 Bacteria 51721
71 Ga0466729_210698 3300042621 Bacteria 20113
72 Ga0466729_276166 3300042621 Bacteria 2270
73 Ga0466735_107052 3300042624 Bacteria 2171
74 Ga0466704_605169 3300042643 Bacteria 3954
75 Ga0466709_172128 3300042648 Bacteria 26267
76 Ga0466708_230723 3300042652 Bacteria 10645
77 Ga0123357_10319315 3300009784 Bacteria 1537
78 Ga0123357_10379759 3300009784 Bacteria 1313
79 Ga0466690_082262 3300042590 Bacteria 20112
80 Ga0466690_177699 3300042590 Bacteria 12588
81 Ga0466692_147419 3300042591 Bacteria 1296
82 Ga0466691_103774 3300042593 Bacteria 2615
83 Ga0466713_054215 3300042602 Bacteria 3064
84 Ga0466722_035543 3300042609 Bacteria 116913
85 Ga0466722_180072 3300042609 Bacteria 4500
86 IMNBL1DRAFT_c0005911 3300000062 Bacteria 6851
87 JGI24705J35276_12215793 3300002504 Bacteria 2018
88 JGI24699J35502_11134009 3300002509 Bacteria 23995
89 JGI24696J40584_12959153 3300002834 Bacteria 4772
90 Ga0068305_10010047 3300005083 Bacteria 10387
91 Ga0068305_11091771 3300005083 Bacteria 3334
92 Ga0466735_136195 3300042624 Bacteria 4189
93 Ga0466703_170534 3300042636 Bacteria 16042
94 Ga0123354_10019892 3300010882 Bacteria 10547
95 Ga0466723_304195 3300042618 Bacteria 13048
96 Ga0456237_0000002 3300041968 Bacteria 104267
97 Ga0466700_064111 3300042600 Bacteria 1471
98 Ga0466707_003680 3300042601 Bacteria 29693
99 Ga0466707_328470 3300042601 Bacteria 9694
100 Ga0466713_100156 3300042602 Bacteria 17601
101 Ga0466719_021458 3300042606 Bacteria 7244
102 Ga0072941_1087397 3300005201 Bacteria 5497
103 Ga0123357_10000629 3300009784 Bacteria 34969
104 Ga0466705_132356 3300042612 Bacteria 7577
105 Ga0466735_232712 3300042624 Bacteria 2118
106 Ga0466703_098405 3300042636 Bacteria 4437
107 Ga0466704_422577 3300042643 Bacteria 21146
108 Ga0466727_291871 3300042655 Bacteria 3712
109 Ga0123356_10023521 3300010049 Bacteria 5797
110 Ga0466715_101945 3300042616 Bacteria 16309
111 Ga0466715_361265 3300042616 Bacteria 6401
112 Ga0466723_108577 3300042618 Bacteria 9165
113 Ga0466728_340299 3300042620 Bacteria 1886
114 Ga0466692_008187 3300042591 Bacteria 121981
115 Ga0466707_067503 3300042601 Unclassified 8949
116 Ga0466707_077733 3300042601 Bacteria 3528
117 Ga0466716_038510 3300042605 Bacteria 24976
118 Ga0466716_412055 3300042605 Bacteria 5781
119 Ga0466719_050060 3300042606 Bacteria 5266
120 Ga0466722_049476 3300042609 Bacteria 19365
121 JGI24699J35502_11134030 3300002509 Bacteria 25274
122 Ga0466735_020932 3300042624 Bacteria 1772
123 Ga0466703_318218 3300042636 Bacteria 1342
124 Ga0466727_151884 3300042655 Bacteria 54336
125 Ga0123354_10011453 3300010882 Bacteria 13707
126 Ga0123354_10132251 3300010882 Bacteria 3143
127 Ga0466711_471579 3300042615 Bacteria 1209
128 Ga0466723_138332 3300042618 Bacteria 7457
129 Ga0466696_234160 3300042596 Bacteria 1583
130 Ga0466701_098566 3300042598 Bacteria 20155
131 Ga0466706_224910 3300042599 Bacteria 52692
132 Ga0466707_416912 3300042601 Bacteria 2136
133 Ga0466713_068672 3300042602 Bacteria 133468
134 Ga0466713_077959 3300042602 Bacteria 15097
135 Ga0466713_153612 3300042602 Bacteria 4823
136 Ga0466719_356439 3300042606 Bacteria 2584

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_177699 Ga0466690_177699_3250_4326 311
2 3300042609 Ga0466722_205158 Ga0466722_205158_9564_10616 311
3 3300042616 Ga0466715_031489 Ga0466715_031489_4470_5522 313
4 3300042601 Ga0466707_067503 Ga0466707_067503_3247_4299 316
5 3300042601 Ga0466707_119043 Ga0466707_119043_351_1403 316
6 3300042621 Ga0466729_276166 Ga0466729_276166_493_1569 321
7 3300002462 JGI24702J35022_10039936 JGI24702J35022_100399362 322
8 3300041968 Ga0456237_0000002 Ga0456237_0000002_90764_91837 322
9 3300042591 Ga0466692_008187 Ga0466692_008187_112803_113876 322
10 3300042591 Ga0466692_190201 Ga0466692_190201_549_1625 322
11 3300042616 Ga0466715_000756 Ga0466715_000756_2749_3825 322
12 3300042591 Ga0466692_030541 Ga0466692_030541_2253_3299 324
13 3300042624 Ga0466735_020932 Ga0466735_020932_122_1174 324
14 3300042624 Ga0466735_076874 Ga0466735_076874_53_1144 324
15 3300042643 Ga0466704_157477 Ga0466704_157477_1325_2377 325
16 3300042590 Ga0466690_082262 Ga0466690_082262_14741_15793 326
17 3300042596 Ga0466696_067335 Ga0466696_067335_3030_4082 326
18 3300042602 Ga0466713_153612 Ga0466713_153612_1275_2321 326
19 3300042612 Ga0466705_072196 Ga0466705_072196_236_1288 326
20 3300009460 Ga0127649_100123 Ga0127649_10012325 327
21 3300009784 Ga0123357_10319315 Ga0123357_103193151 327
22 3300042601 Ga0466707_286082 Ga0466707_286082_1517_2569 328
23 3300042616 Ga0466715_361265 Ga0466715_361265_4423_5469 328
24 3300042618 Ga0466723_108577 Ga0466723_108577_1672_2724 328
25 3300042620 Ga0466728_061783 Ga0466728_061783_4306_5358 328
26 3300042621 Ga0466729_210698 Ga0466729_210698_14823_15875 328
27 3300042624 Ga0466735_107052 Ga0466735_107052_955_2007 328
28 3300002509 JGI24699J35502_11134009 JGI24699J35502_1113400919 329
29 3300042598 Ga0466701_032214 Ga0466701_032214_22999_24051 329
30 3300042599 Ga0466706_289041 Ga0466706_289041_76_1128 329
31 3300042601 Ga0466707_054387 Ga0466707_054387_6712_7764 329
32 3300042601 Ga0466707_287996 Ga0466707_287996_3405_4457 329
33 3300042615 Ga0466711_147763 Ga0466711_147763_8765_9841 329
34 3300042636 Ga0466703_098405 Ga0466703_098405_92_1144 329
35 3300042636 Ga0466703_364164 Ga0466703_364164_905_1957 329
36 3300042590 Ga0466690_394866 Ga0466690_394866_76070_77122 330
37 3300042600 Ga0466700_346378 Ga0466700_346378_437_1489 330
38 3300042601 Ga0466707_328470 Ga0466707_328470_587_1639 330
39 3300042605 Ga0466716_412055 Ga0466716_412055_2011_3063 330
40 3300042606 Ga0466719_021458 Ga0466719_021458_1929_2981 330
41 3300042609 Ga0466722_049476 Ga0466722_049476_9416_10468 330
42 3300042618 Ga0466723_138332 Ga0466723_138332_3030_4082 330
43 3300042624 Ga0466735_072950 Ga0466735_072950_1128_2180 330
44 3300000062 IMNBL1DRAFT_c0003894 IMNBL1DRAFT_00038942 331
45 3300009784 Ga0123357_10018086 Ga0123357_100180867 331
46 3300010049 Ga0123356_10328628 Ga0123356_103286282 331
47 3300010882 Ga0123354_10161851 Ga0123354_101618512 331
48 3300042612 Ga0466705_440502 Ga0466705_440502_2931_3986 331
49 3300042618 Ga0466723_304195 Ga0466723_304195_18_1073 331
50 3300042619 Ga0466726_252612 Ga0466726_252612_1779_2834 331
51 3300042624 Ga0466735_107743 Ga0466735_107743_116_1171 331
52 3300042624 Ga0466735_136195 Ga0466735_136195_970_2025 331
53 3300042606 Ga0466719_050060 Ga0466719_050060_2043_3095 332
54 3300042619 Ga0466726_290438 Ga0466726_290438_111_1187 332
55 3300042624 Ga0466735_116092 Ga0466735_116092_212_1267 332
56 3300042655 Ga0466727_291871 Ga0466727_291871_2274_3326 332
57 3300042596 Ga0466696_088985 Ga0466696_088985_4882_5961 333
58 3300042601 Ga0466707_003680 Ga0466707_003680_27323_28375 333
59 3300042602 Ga0466713_100156 Ga0466713_100156_13311_14363 333
60 3300042612 Ga0466705_132356 Ga0466705_132356_3457_4509 333
61 3300042619 Ga0466726_481576 Ga0466726_481576_386_1438 333
62 3300042643 Ga0466704_605169 Ga0466704_605169_600_1655 333
63 3300042615 Ga0466711_090299 Ga0466711_090299_29295_30347 334
64 3300042602 Ga0466713_116549 Ga0466713_116549_8661_9737 335
65 3300042619 Ga0466726_301924 Ga0466726_301924_3045_4106 335
66 3300005083 Ga0068305_10047177 Ga0068305_100471777 336
67 3300042598 Ga0466701_098566 Ga0466701_098566_12836_13912 336
68 3300042602 Ga0466713_077959 Ga0466713_077959_3564_4616 336
69 3300042620 Ga0466728_340299 Ga0466728_340299_86_1162 336
70 3300042636 Ga0466703_356236 Ga0466703_356236_2103_3173 336
71 3300042596 Ga0466696_234160 Ga0466696_234160_41_1117 337
72 3300042612 Ga0466705_267581 Ga0466705_267581_141_1217 337
73 3300042616 Ga0466715_586319 Ga0466715_586319_206_1282 337
74 3300042624 Ga0466735_038091 Ga0466735_038091_834_1910 337
75 3300042636 Ga0466703_170534 Ga0466703_170534_7884_8960 337
76 3300042655 Ga0466727_151884 Ga0466727_151884_45115_46191 337
77 2225789004 2227266903 2227714785 338
78 3300002834 JGI24696J40584_12959153 JGI24696J40584_129591533 338
79 3300010882 Ga0123354_10011453 Ga0123354_1001145311 338
80 3300042600 Ga0466700_021305 Ga0466700_021305_19233_20309 338
81 3300042600 Ga0466700_064111 Ga0466700_064111_375_1451 338
82 3300042601 Ga0466707_033660 Ga0466707_033660_11649_12725 338
83 3300042602 Ga0466713_054215 Ga0466713_054215_1779_2855 338
84 3300042602 Ga0466713_068672 Ga0466713_068672_18433_19512 338
85 3300042624 Ga0466735_094109 Ga0466735_094109_590_1666 338
86 3300042643 Ga0466704_135353 Ga0466704_135353_400_1452 338
87 3300042648 Ga0466709_165812 Ga0466709_165812_1081_2157 338
88 3300000062 IMNBL1DRAFT_c0005911 IMNBL1DRAFT_00059116 339
89 3300002509 JGI24699J35502_11134030 JGI24699J35502_1113403017 339
90 3300005083 Ga0068305_11091771 Ga0068305_110917712 339
91 3300009784 Ga0123357_10027121 Ga0123357_100271212 339
92 3300010049 Ga0123356_10023521 Ga0123356_100235214 339
93 3300010882 Ga0123354_10019892 Ga0123354_100198923 339
94 3300010882 Ga0123354_10132251 Ga0123354_101322512 339
95 3300042591 Ga0466692_149013 Ga0466692_149013_4424_5503 339
96 3300042616 Ga0466715_474042 Ga0466715_474042_3857_4939 339
97 3300042619 Ga0466726_040298 Ga0466726_040298_5147_6223 339
98 3300042624 Ga0466735_232712 Ga0466735_232712_283_1362 339
99 3300042643 Ga0466704_422577 Ga0466704_422577_17725_18801 339
100 3300042652 Ga0466708_230723 Ga0466708_230723_2978_4054 339
101 3300010882 Ga0123354_10000260 Ga0123354_1000026012 340
102 3300042599 Ga0466706_224910 Ga0466706_224910_47734_48819 340
103 3300042600 Ga0466700_257713 Ga0466700_257713_3924_5057 340
104 3300042615 Ga0466711_471579 Ga0466711_471579_77_1153 340
105 3300042615 Ga0466711_505356 Ga0466711_505356_252_1331 340
106 3300042616 Ga0466715_101945 Ga0466715_101945_8235_9311 340
107 3300042636 Ga0466703_248560 Ga0466703_248560_35144_36220 340
108 3300042648 Ga0466709_172128 Ga0466709_172128_8254_9330 340
109 3300005083 Ga0068305_10010047 Ga0068305_100100476 341
110 3300042591 Ga0466692_147419 Ga0466692_147419_48_1124 341
111 3300042601 Ga0466707_077733 Ga0466707_077733_633_1709 341
112 3300002509 JGI24699J35502_11134035 JGI24699J35502_1113403521 342
113 3300005201 Ga0072941_1087397 Ga0072941_10873974 342
114 3300009784 Ga0123357_10068138 Ga0123357_100681381 342
115 3300010882 Ga0123354_10006316 Ga0123354_1000631612 342
116 3300042593 Ga0466691_103774 Ga0466691_103774_641_1717 342
117 3300042609 Ga0466722_035543 Ga0466722_035543_71004_72053 342
118 3300042621 Ga0466729_041176 Ga0466729_041176_3810_4886 342
119 3300042636 Ga0466703_223669 Ga0466703_223669_42_1121 342
120 3300002504 JGI24705J35276_12215793 JGI24705J35276_122157932 343
121 3300009784 Ga0123357_10000491 Ga0123357_1000049126 343
122 3300009784 Ga0123357_10000629 Ga0123357_1000062910 343
123 3300009784 Ga0123357_10379759 Ga0123357_103797592 343
124 3300010882 Ga0123354_10020243 Ga0123354_100202434 344
125 3300042643 Ga0466704_106682 Ga0466704_106682_1645_2721 344
126 3300010882 Ga0123354_10009913 Ga0123354_100099137 345
127 3300042636 Ga0466703_318218 Ga0466703_318218_121_1197 346
128 3300042605 Ga0466716_038510 Ga0466716_038510_12014_13090 347
129 3300042609 Ga0466722_180072 Ga0466722_180072_3014_4078 347
130 3300042601 Ga0466707_416912 Ga0466707_416912_664_1767 348
131 3300042613 Ga0466710_345832 Ga0466710_345832_374_1438 348
132 3300010882 Ga0123354_10255307 Ga0123354_102553072 351
133 3300042606 Ga0466719_356439 Ga0466719_356439_123_1247 353
134 iso_pr_bacteria 643348524 643422984 357
135 2225789004 2227632958 2228218209 358
136 iso_pr_bacteria 2820759988 2820761536 358
137 iso_pr_bacteria 2820778767 2820779558 358
138 iso_pr_bacteria 2967483437 2967485849 358
139 iso_pr_bacteria 2998929858 2998929994 360
140 iso_pr_bacteria 2940216256 2940217486 362
141 3300042593 Ga0466691_214743 Ga0466691_214743_6364_7518 365
142 3300042643 Ga0466704_307178 Ga0466704_307178_784_1956 369

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22640 ManC_GMP_beta-helix MannoseP isomerase/GMP-like beta-helix domain 305 354 0.84
PF00483 NTP_transferase Nucleotidyl transferase 33 291 0.79

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00483 GO:0009058 biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.