Protein Family IF04949

Metagenome Isolate
309 Members
108 Samples
270 Scaffolds
205.42 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_212240|Ga0466691_212240_4512_5252
Length
246 aa
Sequence
VRLPRNVADLFFFKKNYSYLCDPFVHFVQRETVIVLIIKVIEMPGLIGKKIGMTSVFSAEGKNLPCTVIEVGPCVVTQVKTVEKDGYEAVQLGFQDKKEKHTTKPEMGHFNKAGVTPKRHLVEFKQQGTYKAGDVITVEYFNGDTFVDVIGTSKGKGFQGVVKRHGFKGVGEATLGQSDRQRHPGSIGACSYPAKVFKGTRMAGQMGDKRVTVQNLEVIKLIPEHNLMLIKGSVPGAKGAIVVVQK

πŸ“Š Sample Types

Isolate 12.6%
Metagenome 87.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 30.8%
Unclassified 14.4%
Blattidae 14.4%
Kalotermitidae 13.5%
Formicidae 5.8%
Cicadellidae 3.8%
Rhinotermitidae 3.8%
Armadillidiidae 2.9%
Termopsidae 2.9%
Hydrophilidae 1.9%
Passalidae 1.9%
Aphrophoridae 1.0%
Diaspididae 1.0%
Elmidae 1.0%
Hodotermitidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 299
Eukaryota 0
Viruses 0
Unclassified 10

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
2 2510917001 Candidatus Sulcia muelleri PSPU Isolate Aphrophoridae
3 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
6 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
9 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
10 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
11 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
12 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
13 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
14 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
15 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 2922326829 Bacteroides sp. 224 Isolate Blattidae
18 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
19 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
20 641228484 Candidatus Sulcia muelleri GWSS Isolate Cicadellidae
21 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
22 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
23 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
28 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
29 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
30 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
31 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
32 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
33 644736337 Candidatus Sulcia muelleri SMDSEM Isolate Unclassified
34 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
36 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
37 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
38 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
39 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
40 2540341063 Candidatus Uzinura diaspidicola ASNER Isolate Diaspididae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
43 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
49 2864836148 Arcicella rosea S00070 Isolate Elmidae
50 2920168565 Paludibacter sp. 221 Isolate Blattidae
51 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
52 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
53 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
54 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
55 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
57 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
58 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
59 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
60 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
61 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
62 2599185120 Candidatus Sulcia muelleri BGSS Isolate Cicadellidae
63 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
64 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
65 3004672520 Bacteroides sp. 51 Isolate Blattidae
66 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
67 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
68 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
69 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
70 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
71 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
72 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
73 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
74 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
75 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
76 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
77 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
78 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
79 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
80 646564518 Candidatus Sulcia muelleri DMIN (unscreened) Isolate Cicadellidae
81 648028014 Candidatus Sulcia muelleri CARI Isolate Unclassified
82 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
83 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
84 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
85 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
86 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
87 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
88 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
89 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
90 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
91 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
92 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
93 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
94 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
95 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
96 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
97 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
98 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
99 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
100 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
101 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
102 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
103 638341057 Candidatus Sulcia muelleri Hc Isolate Cicadellidae
104 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
105 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
106 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
107 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
108 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_073791 3300042656 Bacteria 2462
2 Ga0466732_242870 3300042656 Bacteria 97652
3 Ga0123355_10111854 3300009826 Bacteria 4264
4 Ga0466701_034352 3300042598 Bacteria 2625
5 Ga0466706_177822 3300042599 Bacteria 1532
6 Ga0466706_191825 3300042599 Bacteria 26014
7 Ga0466707_416109 3300042601 Bacteria 2339
8 Ga0466713_022772 3300042602 Bacteria 15388
9 Ga0466714_096666 3300042603 Bacteria 172614
10 Ga0466714_101031 3300042603 Bacteria 79046
11 Ga0466716_231031 3300042605 Bacteria 6941
12 Ga0466722_055729 3300042609 Bacteria 3414
13 Ga0466722_161726 3300042609 Bacteria 14778
14 Ga0466698_183996 3300042610 Bacteria 1362
15 2227144728 2225789004 Bacteria 1609
16 2227588237 2225789004 Bacteria 2445
17 IMNBL1DRAFT_c0022789 3300000062 Bacteria 2469
18 IMNBL1DRAFT_c0104212 3300000062 Unclassified 759
19 JGI24702J35022_10193867 3300002462 Bacteria 1160
20 Ga0466656_075682 3300042550 Bacteria 1570
21 Ga0466656_127609 3300042550 Bacteria 23908
22 Ga0466690_168212 3300042590 Bacteria 11803
23 Ga0466692_144683 3300042591 Bacteria 28602
24 Ga0466691_003678 3300042593 Bacteria 14150
25 Ga0466691_204814 3300042593 Bacteria 23707
26 Ga0466694_001267 3300042594 Bacteria 3382
27 Ga0466694_152276 3300042594 Bacteria 1002
28 Ga0466695_344631 3300042595 Bacteria 1338
29 Ga0466710_298213 3300042613 Bacteria 2349
30 Ga0466715_016723 3300042616 Bacteria 13247
31 Ga0466735_041724 3300042624 Bacteria 21992
32 Ga0466703_019525 3300042636 Bacteria 29012
33 Ga0466704_282160 3300042643 Bacteria 2982
34 Ga0466697_090597 3300042611 Bacteria 2716
35 Ga0466705_013366 3300042612 Unclassified 1195
36 Ga0466705_301558 3300042612 Bacteria 7276
37 Ga0123355_10402762 3300009826 Bacteria 1763
38 Ga0123353_10650645 3300010167 Unclassified 1492
39 Ga0123354_10001124 3300010882 Bacteria 31160
40 Ga0466707_081263 3300042601 Bacteria 11553
41 Ga0466707_157624 3300042601 Bacteria 13208
42 Ga0466707_190959 3300042601 Bacteria 10157
43 Ga0466713_026981 3300042602 Bacteria 6138
44 Ga0466713_105738 3300042602 Bacteria 4224
45 Ga0466713_119517 3300042602 Bacteria 7388
46 Ga0466716_335360 3300042605 Bacteria 11224
47 Ga0466719_385682 3300042606 Bacteria 3334
48 Ga0466722_253703 3300042609 Bacteria 9188
49 2227098316 2225789004 Bacteria 1805
50 2227261659 2225789004 Unclassified 1297
51 IMNBL1DRAFT_c0004898 3300000062 Bacteria 7855
52 JGI24702J35022_10004749 3300002462 Bacteria 8038
53 JGI24702J35022_10078113 3300002462 Bacteria 1791
54 JGI24699J35502_11134150 3300002509 Bacteria 37878
55 JGI24696J40584_12790682 3300002834 Bacteria 852
56 Ga0466656_281266 3300042550 Bacteria 2849
57 Ga0466657_360416 3300042582 Bacteria 25893
58 Ga0466690_373916 3300042590 Bacteria 40566
59 Ga0466692_149579 3300042591 Bacteria 83669
60 Ga0466691_133039 3300042593 Unclassified 1563
61 Ga0466691_212240 3300042593 Bacteria 8980
62 Ga0466711_007105 3300042615 Bacteria 19648
63 Ga0466723_082479 3300042618 Bacteria 5238
64 Ga0466723_093881 3300042618 Bacteria 35007
65 Ga0466728_046729 3300042620 Bacteria 48709
66 Ga0466728_183323 3300042620 Bacteria 3927
67 Ga0466731_340577 3300042622 Bacteria 1791
68 Ga0466703_367008 3300042636 Bacteria 30950
69 Ga0466704_278861 3300042643 Bacteria 2576
70 Ga0466704_415186 3300042643 Bacteria 17633
71 Ga0466704_556947 3300042643 Bacteria 7415
72 Ga0466724_51589 3300042649 Bacteria 3661
73 Ga0466708_050057 3300042652 Bacteria 16124
74 Ga0466727_016158 3300042655 Bacteria 3925
75 Ga0466727_099262 3300042655 Bacteria 17474
76 Ga0466705_089766 3300042612 Bacteria 11993
77 Ga0466733_052918 3300042659 Bacteria 1967
78 Ga0123357_10176122 3300009784 Bacteria 2514
79 Ga0466701_038225 3300042598 Bacteria 12164
80 Ga0466700_021305 3300042600 Bacteria 30578
81 Ga0466707_023918 3300042601 Bacteria 27371
82 Ga0466707_098650 3300042601 Bacteria 10173
83 Ga0466713_027800 3300042602 Bacteria 40167
84 Ga0466714_160596 3300042603 Bacteria 3727
85 Ga0466716_380101 3300042605 Bacteria 3190
86 Ga0466722_095046 3300042609 Bacteria 1519
87 2227115821 2225789004 Bacteria 1723
88 2227191089 2225789004 Unclassified 1464
89 2227358898 2225789004 Bacteria 1130
90 2227599341 2225789004 Bacteria 2350
91 IMNBL1DRAFT_c0000677 3300000062 Bacteria 27305
92 JGI24698J34947_10175994 3300002449 Bacteria 860
93 JGI24702J35022_10024045 3300002462 Bacteria 3293
94 Ga0466726_024142 3300042619 Bacteria 22843
95 Ga0466728_085697 3300042620 Bacteria 5860
96 Ga0466728_139914 3300042620 Bacteria 13626
97 Ga0466731_155161 3300042622 Bacteria 1164
98 Ga0466735_087599 3300042624 Bacteria 8967
99 Ga0466735_232692 3300042624 Bacteria 20733
100 Ga0466730_002481 3300042625 Unclassified 1892
101 Ga0466703_200506 3300042636 Bacteria 3211
102 Ga0466703_398293 3300042636 Bacteria 4367
103 Ga0466704_300185 3300042643 Bacteria 2837
104 Ga0466709_351791 3300042648 Bacteria 9960
105 Ga0466727_012114 3300042655 Bacteria 4624
106 Ga0466697_125723 3300042611 Bacteria 1015
107 Ga0123356_10196126 3300010049 Bacteria 2055
108 Ga0123354_10025847 3300010882 Bacteria 9257
109 Ga0123354_10717260 3300010882 Bacteria 694
110 Ga0466700_250859 3300042600 Bacteria 2498
111 Ga0466707_245265 3300042601 Bacteria 1827
112 2227527393 2225789004 Bacteria 16791
113 JGI24698J34947_10016845 3300002449 Bacteria 3965
114 JGI24702J35022_10004653 3300002462 Bacteria 8123
115 Ga0160469_100154 3300012824 Bacteria 76254
116 Ga0160443_100072 3300012848 Bacteria 188813
117 Ga0265387_1051658 3300024582 Unclassified 740
118 Ga0415639_037390 3300038395 Bacteria 1459
119 Ga0466690_191277 3300042590 Bacteria 10665
120 Ga0466692_185674 3300042591 Bacteria 4041
121 Ga0466696_049449 3300042596 Bacteria 3559
122 Ga0466696_367210 3300042596 Bacteria 9324
123 Ga0466711_289238 3300042615 Bacteria 45865
124 Ga0466715_434053 3300042616 Bacteria 17606
125 Ga0466715_533905 3300042616 Bacteria 9746
126 Ga0466723_348988 3300042618 Bacteria 4071
127 Ga0466723_373256 3300042618 Bacteria 33738
128 Ga0466726_273700 3300042619 Bacteria 7069
129 Ga0466728_105299 3300042620 Bacteria 55474
130 Ga0466728_163688 3300042620 Bacteria 3561
131 Ga0466734_013641 3300042623 Bacteria 1854
132 Ga0466735_218590 3300042624 Bacteria 5407
133 Ga0466703_150379 3300042636 Bacteria 5747
134 Ga0466703_249699 3300042636 Bacteria 47455
135 Ga0466704_120465 3300042643 Unclassified 6189
136 Ga0466704_311970 3300042643 Bacteria 2079
137 Ga0466709_126917 3300042648 Bacteria 6968
138 Ga0466708_135787 3300042652 Bacteria 29737
139 Ga0466727_117581 3300042655 Bacteria 2355
140 Ga0466697_087741 3300042611 Bacteria 1495
141 Ga0466705_216293 3300042612 Bacteria 17979
142 Ga0123353_10107177 3300010167 Bacteria 4502
143 Ga0466701_076335 3300042598 Bacteria 60822
144 Ga0466707_417447 3300042601 Bacteria 2269
145 Ga0466722_043304 3300042609 Bacteria 5441
146 IMNBL1DRAFT_c0000182 3300000062 Bacteria 55861
147 IMNBL1DRAFT_c0025258 3300000062 Bacteria 2282
148 JGI24695J34938_10007437 3300002450 Bacteria 6410
149 JGI24702J35022_10000437 3300002462 Bacteria 25160
150 JGI24705J35276_12129808 3300002504 Bacteria 1100
151 Ga0068305_10003312 3300005083 Bacteria 66359
152 Ga0068305_10026156 3300005083 Bacteria 20761
153 Ga0103267_1000029 3300007190 Bacteria 51888
154 Ga0103268_1000539 3300007192 Bacteria 11296
155 Ga0123357_10000278 3300009784 Bacteria 48976
156 Ga0160432_100007 3300012818 Bacteria 498694
157 Ga0466690_085259 3300042590 Bacteria 7863
158 Ga0466690_287618 3300042590 Bacteria 16965
159 Ga0466692_188243 3300042591 Bacteria 86416
160 Ga0466693_271073 3300042592 Bacteria 2236
161 Ga0466691_045847 3300042593 Bacteria 49393
162 Ga0466715_045203 3300042616 Bacteria 21834
163 Ga0466715_060059 3300042616 Bacteria 8464
164 Ga0466723_198099 3300042618 Bacteria 9283
165 Ga0466726_181824 3300042619 Bacteria 1471
166 Ga0466726_271572 3300042619 Bacteria 26331
167 Ga0466728_018673 3300042620 Bacteria 22808
168 Ga0466729_241472 3300042621 Bacteria 12387
169 Ga0466704_281168 3300042643 Unclassified 4380
170 Ga0466725_246848 3300042654 Bacteria 2870
171 Ga0466733_028819 3300042659 Bacteria 27870
172 Ga0466733_043260 3300042659 Bacteria 38032
173 Ga0123357_10005900 3300009784 Bacteria 14780
174 Ga0123357_10030639 3300009784 Bacteria 7293
175 Ga0123354_10040605 3300010882 Bacteria 7198
176 Ga0466706_028809 3300042599 Bacteria 4017
177 Ga0466706_082645 3300042599 Bacteria 7494
178 Ga0466706_201057 3300042599 Bacteria 6582
179 Ga0466700_256244 3300042600 Bacteria 8881
180 Ga0466707_118550 3300042601 Bacteria 4293
181 Ga0466713_077466 3300042602 Bacteria 18852
182 Ga0466713_096596 3300042602 Bacteria 406546
183 Ga0466713_113019 3300042602 Bacteria 16771
184 IMNBL1DRAFT_c0000119 3300000062 Bacteria 71190
185 IMNBL1DRAFT_c0050907 3300000062 Bacteria 1308
186 JGI24699J35502_11015393 3300002509 Bacteria 1421
187 Ga0102740_1000340 3300007140 Bacteria 13154
188 Ga0160456_112168 3300012820 Bacteria 864
189 Ga0466656_332983 3300042550 Bacteria 3079
190 Ga0466690_136616 3300042590 Bacteria 29160
191 Ga0466692_159524 3300042591 Bacteria 46807
192 Ga0466693_110507 3300042592 Bacteria 60686
193 Ga0466696_322276 3300042596 Bacteria 12983
194 Ga0466699_054231 3300042597 Bacteria 7834
195 Ga0466715_206964 3300042616 Bacteria 26549
196 Ga0466723_178800 3300042618 Bacteria 21394
197 Ga0466726_068589 3300042619 Bacteria 1343
198 Ga0466726_144476 3300042619 Bacteria 21004
199 Ga0466703_060092 3300042636 Bacteria 6394
200 Ga0466703_109702 3300042636 Bacteria 21153
201 Ga0466703_348714 3300042636 Bacteria 36764
202 Ga0466703_369160 3300042636 Bacteria 28465
203 Ga0466704_266068 3300042643 Bacteria 12383
204 Ga0466709_083357 3300042648 Bacteria 39489
205 Ga0466709_118201 3300042648 Bacteria 25211
206 Ga0466708_143755 3300042652 Bacteria 8647
207 Ga0466725_102645 3300042654 Bacteria 1611
208 Ga0466705_183402 3300042612 Bacteria 3105
209 Ga0466733_122912 3300042659 Bacteria 8689
210 Ga0466733_174455 3300042659 Bacteria 4998
211 Ga0123354_10006670 3300010882 Bacteria 17209
212 Ga0466706_183911 3300042599 Bacteria 19618
213 Ga0466700_315313 3300042600 Bacteria 7042
214 Ga0466713_066156 3300042602 Bacteria 5649
215 Ga0466716_065737 3300042605 Bacteria 4990
216 Ga0466719_204065 3300042606 Bacteria 20051
217 Ga0466719_554685 3300042606 Bacteria 12056
218 Ga0466722_088416 3300042609 Bacteria 9449
219 JGI24702J35022_10021314 3300002462 Bacteria 3515
220 JGI24705J35276_12174723 3300002504 Bacteria 1319
221 CVPL010W_10000676 3300002931 Bacteria 64066
222 Ga0102734_1000653 3300007129 Bacteria 9616
223 Ga0123357_10000330 3300009784 Bacteria 44905
224 Ga0466690_032772 3300042590 Bacteria 29534
225 Ga0466690_175771 3300042590 Bacteria 56622
226 Ga0466692_168163 3300042591 Bacteria 3791
227 Ga0466691_039529 3300042593 Bacteria 29822
228 Ga0466696_057464 3300042596 Bacteria 6383
229 Ga0466696_195859 3300042596 Bacteria 1912
230 Ga0466711_050658 3300042615 Bacteria 24311
231 Ga0466726_269193 3300042619 Bacteria 1082
232 Ga0466728_069680 3300042620 Bacteria 49538
233 Ga0466730_020607 3300042625 Bacteria 3112
234 Ga0466730_098534 3300042625 Bacteria 2323
235 Ga0466703_297814 3300042636 Bacteria 1671
236 Ga0466727_016509 3300042655 Bacteria 1517
237 Ga0466727_050462 3300042655 Bacteria 20965
238 Ga0466705_097898 3300042612 Bacteria 6160
239 Ga0123353_10019531 3300010167 Bacteria 10075
240 Ga0123354_10135024 3300010882 Bacteria 3091
241 Ga0123354_10423215 3300010882 Bacteria 1104
242 Ga0466706_064416 3300042599 Bacteria 22081
243 Ga0466706_126288 3300042599 Bacteria 17453
244 Ga0466700_428766 3300042600 Bacteria 1471
245 Ga0466707_230802 3300042601 Bacteria 16904
246 Ga0466713_129806 3300042602 Bacteria 35433
247 Ga0466716_024609 3300042605 Bacteria 2672
248 Ga0466716_122468 3300042605 Bacteria 22074
249 Ga0466719_025390 3300042606 Bacteria 13141
250 IMNBL1DRAFT_c0002428 3300000062 Bacteria 12971
251 IMNBL1DRAFT_c0024209 3300000062 Bacteria 2360
252 JGI24702J35022_10000194 3300002462 Bacteria 32822
253 JGI24702J35022_10002652 3300002462 Bacteria 10856
254 JGI24699J35502_11133712 3300002509 Bacteria 14056
255 JGI24696J40584_12961337 3300002834 Bacteria 13784
256 Ga0103264_1000100 3300007188 Bacteria 49857
257 Ga0466690_248799 3300042590 Bacteria 9265
258 Ga0466693_220652 3300042592 Bacteria 4010
259 Ga0466711_062266 3300042615 Bacteria 2461
260 Ga0466715_024383 3300042616 Bacteria 26866
261 Ga0466715_154449 3300042616 Bacteria 23802
262 Ga0466715_266187 3300042616 Bacteria 25878
263 Ga0466718_030954 3300042617 Bacteria 1827
264 Ga0466728_117468 3300042620 Bacteria 23405
265 Ga0466735_015132 3300042624 Bacteria 3209
266 Ga0466730_009837 3300042625 Bacteria 325641
267 Ga0466703_269865 3300042636 Bacteria 9316
268 Ga0466704_004444 3300042643 Bacteria 24992
269 Ga0466708_014146 3300042652 Bacteria 33245
270 Ga0466727_247918 3300042655 Bacteria 10698

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_133039 Ga0466691_133039_988_1521 167
2 3300042636 Ga0466703_249699 Ga0466703_249699_31047_31664 176
3 3300000062 IMNBL1DRAFT_c0104212 IMNBL1DRAFT_01042121 194
4 3300042619 Ga0466726_024142 Ga0466726_024142_2641_3255 194
5 3300042602 Ga0466713_119517 Ga0466713_119517_1022_1642 195
6 3300042612 Ga0466705_183402 Ga0466705_183402_1588_2175 195
7 3300042621 Ga0466729_241472 Ga0466729_241472_6905_7525 195
8 3300042659 Ga0466733_174455 Ga0466733_174455_3061_3681 195
9 3300042612 Ga0466705_089766 Ga0466705_089766_3627_4244 196
10 3300042620 Ga0466728_139914 Ga0466728_139914_11689_12306 196
11 3300000062 IMNBL1DRAFT_c0050907 IMNBL1DRAFT_00509071 197
12 3300002834 JGI24696J40584_12961337 JGI24696J40584_1296133725 197
13 3300038395 Ga0415639_037390 Ga0415639_037390_828_1445 197
14 3300009784 Ga0123357_10005900 Ga0123357_1000590023 198
15 3300042550 Ga0466656_332983 Ga0466656_332983_1797_2414 198
16 3300042590 Ga0466690_136616 Ga0466690_136616_24677_25294 198
17 3300042599 Ga0466706_028809 Ga0466706_028809_90_707 198
18 3300042619 Ga0466726_144476 Ga0466726_144476_15311_15928 198
19 3300002462 JGI24702J35022_10002652 JGI24702J35022_1000265213 199
20 3300012820 Ga0160456_112168 Ga0160456_1121682 199
21 3300042596 Ga0466696_367210 Ga0466696_367210_6178_6795 199
22 3300042655 Ga0466727_099262 Ga0466727_099262_3686_4303 200
23 3300002462 JGI24702J35022_10000437 JGI24702J35022_1000043721 201
24 3300042655 Ga0466727_247918 Ga0466727_247918_2658_3296 202
25 2225789004 2227098316 2227480652 204
26 2225789004 2227115821 2227506647 204
27 2225789004 2227191089 2227612332 204
28 2225789004 2227261659 2227708061 204
29 3300042550 Ga0466656_281266 Ga0466656_281266_1299_1913 204
30 3300042582 Ga0466657_360416 Ga0466657_360416_17749_18363 204
31 3300042590 Ga0466690_085259 Ga0466690_085259_95_709 204
32 3300042590 Ga0466690_191277 Ga0466690_191277_141_755 204
33 3300042590 Ga0466690_287618 Ga0466690_287618_6838_7452 204
34 3300042590 Ga0466690_373916 Ga0466690_373916_8046_8660 204
35 3300042591 Ga0466692_144683 Ga0466692_144683_20602_21216 204
36 3300042591 Ga0466692_159524 Ga0466692_159524_21724_22338 204
37 3300042591 Ga0466692_168163 Ga0466692_168163_3112_3726 204
38 3300042591 Ga0466692_188243 Ga0466692_188243_43152_43766 204
39 3300042592 Ga0466693_271073 Ga0466693_271073_1146_1760 204
40 3300042593 Ga0466691_003678 Ga0466691_003678_12910_13524 204
41 3300042594 Ga0466694_001267 Ga0466694_001267_282_896 204
42 3300042595 Ga0466695_344631 Ga0466695_344631_659_1273 204
43 3300042596 Ga0466696_057464 Ga0466696_057464_2274_2888 204
44 3300042596 Ga0466696_195859 Ga0466696_195859_168_782 204
45 3300042598 Ga0466701_038225 Ga0466701_038225_6662_7276 204
46 3300042600 Ga0466700_250859 Ga0466700_250859_1224_1838 204
47 3300042600 Ga0466700_256244 Ga0466700_256244_3398_4012 204
48 3300042600 Ga0466700_315313 Ga0466700_315313_4583_5197 204
49 3300042601 Ga0466707_081263 Ga0466707_081263_10307_10921 204
50 3300042601 Ga0466707_118550 Ga0466707_118550_10_624 204
51 3300042601 Ga0466707_157624 Ga0466707_157624_73_687 204
52 3300042601 Ga0466707_190959 Ga0466707_190959_8388_9002 204
53 3300042601 Ga0466707_230802 Ga0466707_230802_1842_2456 204
54 3300042601 Ga0466707_417447 Ga0466707_417447_788_1402 204
55 3300042602 Ga0466713_022772 Ga0466713_022772_1594_2208 204
56 3300042602 Ga0466713_026981 Ga0466713_026981_3421_4035 204
57 3300042605 Ga0466716_122468 Ga0466716_122468_18378_18992 204
58 3300042605 Ga0466716_231031 Ga0466716_231031_64_678 204
59 3300042605 Ga0466716_380101 Ga0466716_380101_110_724 204
60 3300042606 Ga0466719_025390 Ga0466719_025390_5434_6048 204
61 3300042606 Ga0466719_385682 Ga0466719_385682_158_772 204
62 3300042606 Ga0466719_554685 Ga0466719_554685_7204_7818 204
63 3300042609 Ga0466722_043304 Ga0466722_043304_2224_2838 204
64 3300042609 Ga0466722_088416 Ga0466722_088416_6221_6835 204
65 3300042609 Ga0466722_095046 Ga0466722_095046_501_1115 204
66 3300042610 Ga0466698_183996 Ga0466698_183996_41_655 204
67 3300042611 Ga0466697_090597 Ga0466697_090597_1697_2311 204
68 3300042612 Ga0466705_013366 Ga0466705_013366_562_1176 204
69 3300042612 Ga0466705_097898 Ga0466705_097898_2284_2898 204
70 3300042612 Ga0466705_216293 Ga0466705_216293_14783_15397 204
71 3300042612 Ga0466705_301558 Ga0466705_301558_5568_6182 204
72 3300042615 Ga0466711_050658 Ga0466711_050658_15614_16228 204
73 3300042616 Ga0466715_016723 Ga0466715_016723_7101_7715 204
74 3300042616 Ga0466715_024383 Ga0466715_024383_1230_1844 204
75 3300042616 Ga0466715_060059 Ga0466715_060059_4784_5398 204
76 3300042616 Ga0466715_206964 Ga0466715_206964_3067_3681 204
77 3300042616 Ga0466715_266187 Ga0466715_266187_383_997 204
78 3300042618 Ga0466723_082479 Ga0466723_082479_4171_4785 204
79 3300042618 Ga0466723_198099 Ga0466723_198099_6135_6749 204
80 3300042618 Ga0466723_348988 Ga0466723_348988_1556_2170 204
81 3300042619 Ga0466726_068589 Ga0466726_068589_84_698 204
82 3300042619 Ga0466726_181824 Ga0466726_181824_148_762 204
83 3300042620 Ga0466728_046729 Ga0466728_046729_25229_25843 204
84 3300042620 Ga0466728_069680 Ga0466728_069680_25604_26218 204
85 3300042620 Ga0466728_085697 Ga0466728_085697_4193_4807 204
86 3300042620 Ga0466728_105299 Ga0466728_105299_31178_31792 204
87 3300042620 Ga0466728_163688 Ga0466728_163688_1506_2120 204
88 3300042623 Ga0466734_013641 Ga0466734_013641_336_950 204
89 3300042624 Ga0466735_015132 Ga0466735_015132_334_948 204
90 3300042625 Ga0466730_002481 Ga0466730_002481_1158_1772 204
91 3300042625 Ga0466730_020607 Ga0466730_020607_1767_2381 204
92 3300042625 Ga0466730_098534 Ga0466730_098534_1001_1666 204
93 3300042636 Ga0466703_060092 Ga0466703_060092_2752_3366 204
94 3300042636 Ga0466703_200506 Ga0466703_200506_2343_2957 204
95 3300042636 Ga0466703_269865 Ga0466703_269865_2764_3378 204
96 3300042636 Ga0466703_297814 Ga0466703_297814_556_1170 204
97 3300042636 Ga0466703_348714 Ga0466703_348714_7652_8266 204
98 3300042636 Ga0466703_369160 Ga0466703_369160_14457_15071 204
99 3300042636 Ga0466703_398293 Ga0466703_398293_3051_3665 204
100 3300042643 Ga0466704_004444 Ga0466704_004444_16804_17418 204
101 3300042643 Ga0466704_120465 Ga0466704_120465_5462_6076 204
102 3300042643 Ga0466704_266068 Ga0466704_266068_8403_9017 204
103 3300042643 Ga0466704_278861 Ga0466704_278861_179_793 204
104 3300042643 Ga0466704_281168 Ga0466704_281168_3588_4202 204
105 3300042643 Ga0466704_282160 Ga0466704_282160_2289_2903 204
106 3300042643 Ga0466704_556947 Ga0466704_556947_1938_2552 204
107 3300042648 Ga0466709_118201 Ga0466709_118201_20081_20695 204
108 3300042648 Ga0466709_126917 Ga0466709_126917_5329_5943 204
109 3300042652 Ga0466708_014146 Ga0466708_014146_4759_5373 204
110 3300042652 Ga0466708_050057 Ga0466708_050057_142_756 204
111 3300042655 Ga0466727_016158 Ga0466727_016158_268_882 204
112 3300042655 Ga0466727_117581 Ga0466727_117581_405_1019 204
113 3300042656 Ga0466732_073791 Ga0466732_073791_1571_2185 204
114 3300042659 Ga0466733_052918 Ga0466733_052918_1332_1946 204
115 iso_pr_bacteria 2695420931 2698110971 204
116 iso_pr_bacteria 2820759988 2820760198 204
117 iso_pr_bacteria 2820762746 2820764341 204
118 iso_pr_bacteria 2910926975 2910930131 204
119 iso_pr_bacteria 2910949487 2910951321 204
120 iso_pr_bacteria 2940193328 2940194751 204
121 iso_pr_bacteria 2940336608 2940338028 204
122 iso_pr_bacteria 2967483437 2967487569 204
123 iso_pr_bacteria 643348524 643422734 204
124 iso_pr_bacteria 8100166142 8100169619 204
125 2225789004 2227358898 2227807167 205
126 2225789004 2227588237 2228144837 205
127 2225789004 2227599341 2228163977 205
128 3300000062 IMNBL1DRAFT_c0000182 IMNBL1DRAFT_000018248 205
129 3300000062 IMNBL1DRAFT_c0004898 IMNBL1DRAFT_00048984 205
130 3300000062 IMNBL1DRAFT_c0022789 IMNBL1DRAFT_00227892 205
131 3300002462 JGI24702J35022_10004653 JGI24702J35022_100046535 205
132 3300002504 JGI24705J35276_12129808 JGI24705J35276_121298081 205
133 3300002509 JGI24699J35502_11015393 JGI24699J35502_110153932 205
134 3300002509 JGI24699J35502_11133712 JGI24699J35502_1113371210 205
135 3300002509 JGI24699J35502_11134150 JGI24699J35502_1113415044 205
136 3300007190 Ga0103267_1000029 Ga0103267_100002943 205
137 3300007192 Ga0103268_1000539 Ga0103268_10005393 205
138 3300009784 Ga0123357_10000330 Ga0123357_1000033015 205
139 3300009784 Ga0123357_10030639 Ga0123357_100306394 205
140 3300009784 Ga0123357_10176122 Ga0123357_101761223 205
141 3300010049 Ga0123356_10196126 Ga0123356_101961263 205
142 3300010167 Ga0123353_10650645 Ga0123353_106506453 205
143 3300010882 Ga0123354_10001124 Ga0123354_1000112436 205
144 3300010882 Ga0123354_10006670 Ga0123354_1000667015 205
145 3300010882 Ga0123354_10025847 Ga0123354_1002584711 205
146 3300010882 Ga0123354_10135024 Ga0123354_101350243 205
147 3300010882 Ga0123354_10717260 Ga0123354_107172601 205
148 3300042550 Ga0466656_127609 Ga0466656_127609_21774_22391 205
149 3300042590 Ga0466690_032772 Ga0466690_032772_17927_18544 205
150 3300042590 Ga0466690_175771 Ga0466690_175771_49844_50461 205
151 3300042590 Ga0466690_248799 Ga0466690_248799_2982_3599 205
152 3300042592 Ga0466693_220652 Ga0466693_220652_259_876 205
153 3300042593 Ga0466691_039529 Ga0466691_039529_25091_25708 205
154 3300042593 Ga0466691_045847 Ga0466691_045847_27878_28495 205
155 3300042593 Ga0466691_204814 Ga0466691_204814_16822_17439 205
156 3300042594 Ga0466694_152276 Ga0466694_152276_221_838 205
157 3300042596 Ga0466696_049449 Ga0466696_049449_1129_1746 205
158 3300042597 Ga0466699_054231 Ga0466699_054231_864_1481 205
159 3300042599 Ga0466706_064416 Ga0466706_064416_13051_13668 205
160 3300042599 Ga0466706_082645 Ga0466706_082645_3456_4073 205
161 3300042599 Ga0466706_126288 Ga0466706_126288_11160_11777 205
162 3300042599 Ga0466706_177822 Ga0466706_177822_223_840 205
163 3300042599 Ga0466706_183911 Ga0466706_183911_13588_14205 205
164 3300042599 Ga0466706_191825 Ga0466706_191825_5745_6362 205
165 3300042600 Ga0466700_428766 Ga0466700_428766_568_1185 205
166 3300042601 Ga0466707_098650 Ga0466707_098650_8367_8984 205
167 3300042601 Ga0466707_416109 Ga0466707_416109_313_930 205
168 3300042602 Ga0466713_027800 Ga0466713_027800_18105_18722 205
169 3300042602 Ga0466713_077466 Ga0466713_077466_15479_16096 205
170 3300042605 Ga0466716_024609 Ga0466716_024609_1697_2314 205
171 3300042605 Ga0466716_335360 Ga0466716_335360_8913_9530 205
172 3300042606 Ga0466719_204065 Ga0466719_204065_15360_15977 205
173 3300042609 Ga0466722_161726 Ga0466722_161726_12977_13594 205
174 3300042611 Ga0466697_125723 Ga0466697_125723_56_673 205
175 3300042613 Ga0466710_298213 Ga0466710_298213_879_1496 205
176 3300042615 Ga0466711_289238 Ga0466711_289238_39403_40020 205
177 3300042616 Ga0466715_154449 Ga0466715_154449_6388_7005 205
178 3300042616 Ga0466715_434053 Ga0466715_434053_3685_4302 205
179 3300042617 Ga0466718_030954 Ga0466718_030954_1031_1648 205
180 3300042618 Ga0466723_093881 Ga0466723_093881_4870_5487 205
181 3300042618 Ga0466723_373256 Ga0466723_373256_14483_15100 205
182 3300042619 Ga0466726_273700 Ga0466726_273700_166_783 205
183 3300042620 Ga0466728_018673 Ga0466728_018673_5124_5741 205
184 3300042620 Ga0466728_117468 Ga0466728_117468_4713_5330 205
185 3300042622 Ga0466731_340577 Ga0466731_340577_914_1531 205
186 3300042624 Ga0466735_087599 Ga0466735_087599_125_742 205
187 3300042624 Ga0466735_218590 Ga0466735_218590_4595_5212 205
188 3300042624 Ga0466735_232692 Ga0466735_232692_6071_6688 205
189 3300042625 Ga0466730_009837 Ga0466730_009837_319636_320253 205
190 3300042636 Ga0466703_019525 Ga0466703_019525_28231_28848 205
191 3300042636 Ga0466703_109702 Ga0466703_109702_3817_4434 205
192 3300042636 Ga0466703_150379 Ga0466703_150379_4897_5514 205
193 3300042643 Ga0466704_300185 Ga0466704_300185_1422_2039 205
194 3300042643 Ga0466704_415186 Ga0466704_415186_11012_11629 205
195 3300042648 Ga0466709_083357 Ga0466709_083357_13726_14343 205
196 3300042648 Ga0466709_351791 Ga0466709_351791_7911_8528 205
197 3300042652 Ga0466708_143755 Ga0466708_143755_7988_8605 205
198 3300042655 Ga0466727_012114 Ga0466727_012114_952_1569 205
199 3300042655 Ga0466727_016509 Ga0466727_016509_716_1333 205
200 3300042655 Ga0466727_050462 Ga0466727_050462_14865_15482 205
201 3300042659 Ga0466733_028819 Ga0466733_028819_23381_23998 205
202 3300042659 Ga0466733_043260 Ga0466733_043260_32644_33261 205
203 iso_pr_bacteria 2864836148 2864836264 205
204 iso_pr_bacteria 2922326829 2922327951 205
205 iso_pr_bacteria 3004672520 3004672627 205
206 iso_pr_bacteria 644736337 644951103 205
207 2225789004 2227144728 2227548194 206
208 2225789004 2227527393 2228036314 206
209 3300000062 IMNBL1DRAFT_c0000677 IMNBL1DRAFT_000067746 206
210 3300002449 JGI24698J34947_10016845 JGI24698J34947_100168451 206
211 3300002449 JGI24698J34947_10175994 JGI24698J34947_101759942 206
212 3300002462 JGI24702J35022_10000194 JGI24702J35022_1000019423 206
213 3300002462 JGI24702J35022_10021314 JGI24702J35022_100213143 206
214 3300002462 JGI24702J35022_10024045 JGI24702J35022_100240454 206
215 3300002834 JGI24696J40584_12790682 JGI24696J40584_127906822 206
216 3300005083 Ga0068305_10003312 Ga0068305_100033129 206
217 3300005083 Ga0068305_10026156 Ga0068305_100261564 206
218 3300007140 Ga0102740_1000340 Ga0102740_100034023 206
219 3300010167 Ga0123353_10107177 Ga0123353_101071772 206
220 3300012818 Ga0160432_100007 Ga0160432_100007348 206
221 3300012824 Ga0160469_100154 Ga0160469_10015424 206
222 3300024582 Ga0265387_1051658 Ga0265387_10516582 206
223 3300042591 Ga0466692_149579 Ga0466692_149579_15827_16447 206
224 3300042596 Ga0466696_322276 Ga0466696_322276_105_725 206
225 3300042599 Ga0466706_201057 Ga0466706_201057_2566_3186 206
226 3300042601 Ga0466707_023918 Ga0466707_023918_9434_10054 206
227 3300042601 Ga0466707_245265 Ga0466707_245265_1135_1755 206
228 3300042602 Ga0466713_066156 Ga0466713_066156_4009_4629 206
229 3300042602 Ga0466713_096596 Ga0466713_096596_312968_313588 206
230 3300042602 Ga0466713_105738 Ga0466713_105738_3585_4205 206
231 3300042602 Ga0466713_113019 Ga0466713_113019_6961_7581 206
232 3300042603 Ga0466714_101031 Ga0466714_101031_62190_62810 206
233 3300042603 Ga0466714_160596 Ga0466714_160596_861_1481 206
234 3300042605 Ga0466716_065737 Ga0466716_065737_3499_4119 206
235 3300042609 Ga0466722_055729 Ga0466722_055729_1603_2223 206
236 3300042609 Ga0466722_253703 Ga0466722_253703_1742_2362 206
237 3300042611 Ga0466697_087741 Ga0466697_087741_599_1219 206
238 3300042615 Ga0466711_007105 Ga0466711_007105_14551_15171 206
239 3300042616 Ga0466715_045203 Ga0466715_045203_14942_15562 206
240 3300042618 Ga0466723_178800 Ga0466723_178800_16622_17242 206
241 3300042619 Ga0466726_269193 Ga0466726_269193_145_765 206
242 3300042619 Ga0466726_271572 Ga0466726_271572_17614_18234 206
243 3300042620 Ga0466728_183323 Ga0466728_183323_1503_2123 206
244 3300042624 Ga0466735_041724 Ga0466735_041724_19494_20114 206
245 3300042643 Ga0466704_311970 Ga0466704_311970_1419_2039 206
246 3300042652 Ga0466708_135787 Ga0466708_135787_24246_24866 206
247 3300042656 Ga0466732_242870 Ga0466732_242870_42147_42767 206
248 3300042659 Ga0466733_122912 Ga0466733_122912_6050_6670 206
249 iso_pr_bacteria 2510917001 2510921623 206
250 iso_pr_bacteria 2540341063 2540521727 206
251 iso_pr_bacteria 2599185120 2599224776 206
252 iso_pr_bacteria 2695420314 2695473240 206
253 iso_pr_bacteria 2718218155 2720329001 206
254 iso_pr_bacteria 2820751898 2820753067 206
255 iso_pr_bacteria 2820776227 2820777713 206
256 iso_pr_bacteria 2820789850 2820790627 206
257 iso_pr_bacteria 2873600114 2873602039 206
258 iso_pr_bacteria 2873610414 2873612400 206
259 iso_pr_bacteria 2910930387 2910931362 206
260 iso_pr_bacteria 2910942425 2910944130 206
261 iso_pr_bacteria 2910959314 2910959538 206
262 iso_pr_bacteria 2920168565 2920170053 206
263 iso_pr_bacteria 2940244548 2940244769 206
264 iso_pr_bacteria 2940248789 2940249009 206
265 iso_pr_bacteria 2940253009 2940253265 206
266 iso_pr_bacteria 2940257232 2940257683 206
267 iso_pr_bacteria 638341057 638952561 206
268 iso_pr_bacteria 641228484 641331763 206
269 iso_pr_bacteria 646564518 646708317 206
270 iso_pr_bacteria 648028014 648180281 206
271 3300000062 IMNBL1DRAFT_c0002428 IMNBL1DRAFT_000242812 207
272 3300000062 IMNBL1DRAFT_c0024209 IMNBL1DRAFT_00242094 207
273 3300000062 IMNBL1DRAFT_c0025258 IMNBL1DRAFT_00252582 207
274 3300002462 JGI24702J35022_10078113 JGI24702J35022_100781133 207
275 3300002504 JGI24705J35276_12174723 JGI24705J35276_121747232 207
276 3300009826 Ga0123355_10111854 Ga0123355_101118543 207
277 3300009826 Ga0123355_10402762 Ga0123355_104027623 207
278 3300010167 Ga0123353_10019531 Ga0123353_100195315 207
279 3300010882 Ga0123354_10423215 Ga0123354_104232152 207
280 3300042550 Ga0466656_075682 Ga0466656_075682_497_1120 207
281 3300002931 CVPL010W_10000676 CVPL010W_1000067614 209
282 3300007129 Ga0102734_1000653 Ga0102734_10006534 209
283 3300007188 Ga0103264_1000100 Ga0103264_100010058 209
284 3300042622 Ga0466731_155161 Ga0466731_155161_332_997 209
285 3300042598 Ga0466701_076335 Ga0466701_076335_12943_13578 211
286 3300042600 Ga0466700_021305 Ga0466700_021305_11318_11953 211
287 3300042602 Ga0466713_129806 Ga0466713_129806_17741_18376 211
288 3300042636 Ga0466703_367008 Ga0466703_367008_17502_18137 211
289 iso_pr_bacteria 2820778767 2820779225 211
290 iso_pr_bacteria 2940216256 2940217617 211
291 3300000062 IMNBL1DRAFT_c0000119 IMNBL1DRAFT_00001199 212
292 3300002462 JGI24702J35022_10004749 JGI24702J35022_100047496 212
293 3300002462 JGI24702J35022_10193867 JGI24702J35022_101938672 212
294 3300009784 Ga0123357_10000278 Ga0123357_1000027832 212
295 3300042592 Ga0466693_110507 Ga0466693_110507_30367_31053 212
296 3300042590 Ga0466690_168212 Ga0466690_168212_8955_9599 214
297 3300042598 Ga0466701_034352 Ga0466701_034352_188_832 214
298 3300012848 Ga0160443_100072 Ga0160443_10007210 215
299 3300042591 Ga0466692_185674 Ga0466692_185674_2027_2695 222
300 3300042649 Ga0466724_51589 Ga0466724_51589_1921_2598 225
301 3300042654 Ga0466725_246848 Ga0466725_246848_207_884 225
302 3300042615 Ga0466711_062266 Ga0466711_062266_1755_2435 226
303 3300042616 Ga0466715_533905 Ga0466715_533905_4404_5084 226
304 3300042654 Ga0466725_102645 Ga0466725_102645_588_1268 226
305 3300002450 JGI24695J34938_10007437 JGI24695J34938_100074373 228
306 iso_pr_bacteria 2509276035 2509457223 228
307 3300010882 Ga0123354_10040605 Ga0123354_1004060512 235
308 3300042603 Ga0466714_096666 Ga0466714_096666_29340_30047 235
309 3300042593 Ga0466691_212240 Ga0466691_212240_4512_5252 246

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00297 Ribosomal_L3 Ribosomal protein L3 124 221 0.83

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.69 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.