Protein Family IF04942
Metagenome
Isolate
107
Members
43
Samples
98
Scaffolds
311.07
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_193627|Ga0466691_193627_2261_3328
- Length
- 355 aa
- Sequence
- MDFFNDGAVPKLQFLEGPQIQSKYFCPLSYIILYLTYNEEFVEADMVKSKHVLFFLGFLPFLFSCSINKMAINAISDALGGSGSSEVFTGDSDPRLVGDAIPFALKMYETLLSQNPDHQGLLLTTGSLFIMYANVFVQGEAEMLPPIDKYEERHEGLDRAKKLYLRGTAILYSALDEKYPGFSGATVREGTLEAYLEKLTKEDVPLIYWTVAGTLAAYSIDIFDFELGSAIPELTAMIARAYELDPDFNRGAIDEFYILLYASLPEVLGGDTARAEVHFQRAVEKTRGLSAGPYVSYAQAVCVPAQDYDAFKANLEKALAVDPDEDPANRLANIISQRKARHLLETAYELFTFLE
Sample Types
Isolate
8.4%
Metagenome
91.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.5%
Kalotermitidae
29.3%
Unclassified
24.4%
Rhinotermitidae
4.9%
Taxonomy
Archaea
1
Bacteria
105
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 12 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 24 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 38 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 39 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 40 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_147891 | 3300042614 | Bacteria | 12053 |
| 2 | Ga0466718_053727 | 3300042617 | Bacteria | 2173 |
| 3 | Ga0264413_123457 | 3300024493 | Bacteria | 4470 |
| 4 | Ga0466691_033077 | 3300042593 | Bacteria | 2956 |
| 5 | Ga0466691_145105 | 3300042593 | Bacteria | 12618 |
| 6 | Ga0466696_146595 | 3300042596 | Bacteria | 5217 |
| 7 | Ga0466704_019189 | 3300042643 | Bacteria | 11079 |
| 8 | Ga0466708_169359 | 3300042652 | Bacteria | 4063 |
| 9 | Ga0072941_1017575 | 3300005201 | Bacteria | 12242 |
| 10 | Ga0466705_441301 | 3300042612 | Bacteria | 4297 |
| 11 | Ga0466712_106017 | 3300042614 | Bacteria | 17927 |
| 12 | Ga0466715_273689 | 3300042616 | Bacteria | 22038 |
| 13 | Ga0466715_359806 | 3300042616 | Bacteria | 2652 |
| 14 | Ga0466715_554015 | 3300042616 | Bacteria | 5583 |
| 15 | Ga0466715_630818 | 3300042616 | Bacteria | 6987 |
| 16 | Ga0415639_015345 | 3300038395 | Bacteria | 2034 |
| 17 | Ga0466693_032981 | 3300042592 | Bacteria | 51645 |
| 18 | Ga0466694_318125 | 3300042594 | Bacteria | 3302 |
| 19 | Ga0466703_202686 | 3300042636 | Bacteria | 7488 |
| 20 | JGI24695J34938_10026851 | 3300002450 | Bacteria | 2731 |
| 21 | Ga0072941_1017576 | 3300005201 | Bacteria | 11341 |
| 22 | Ga0072941_1026918 | 3300005201 | Bacteria | 3634 |
| 23 | Ga0072941_1041073 | 3300005201 | Bacteria | 6329 |
| 24 | Ga0466705_197331 | 3300042612 | Bacteria | 9344 |
| 25 | Ga0466732_137851 | 3300042656 | Bacteria | 16549 |
| 26 | Ga0466733_000537 | 3300042659 | Bacteria | 1726 |
| 27 | Ga0466718_046448 | 3300042617 | Bacteria | 2657 |
| 28 | Ga0466723_112592 | 3300042618 | Bacteria | 4856 |
| 29 | Ga0123356_10044935 | 3300010049 | Bacteria | 4111 |
| 30 | Ga0123356_10900616 | 3300010049 | Bacteria | 1056 |
| 31 | Ga0123353_10130653 | 3300010167 | Bacteria | 4030 |
| 32 | Ga0264413_100124 | 3300024493 | Bacteria | 5781 |
| 33 | Ga0264413_107400 | 3300024493 | Bacteria | 71506 |
| 34 | Ga0466696_230252 | 3300042596 | Bacteria | 4408 |
| 35 | Ga0466731_260203 | 3300042622 | Bacteria | 5121 |
| 36 | Ga0466709_388429 | 3300042648 | Bacteria | 9847 |
| 37 | Ga0466708_166017 | 3300042652 | Bacteria | 2089 |
| 38 | Ga0466720_056369 | 3300042607 | Bacteria | 4454 |
| 39 | Ga0466698_042228 | 3300042610 | Bacteria | 2372 |
| 40 | JGI24698J34947_10000538 | 3300002449 | Bacteria | 17931 |
| 41 | JGI24695J34938_10004542 | 3300002450 | Bacteria | 9050 |
| 42 | JGI24695J34938_10006779 | 3300002450 | Bacteria | 6805 |
| 43 | Ga0072940_1031316 | 3300005200 | Bacteria | 5302 |
| 44 | Ga0072941_1093132 | 3300005201 | Bacteria | 3195 |
| 45 | Ga0466712_089435 | 3300042614 | Bacteria | 21004 |
| 46 | Ga0466728_331200 | 3300042620 | Bacteria | 7944 |
| 47 | Ga0264413_101091 | 3300024493 | Bacteria | 3315 |
| 48 | Ga0466699_020786 | 3300042597 | Bacteria | 6530 |
| 49 | Ga0466704_294970 | 3300042643 | Bacteria | 1822 |
| 50 | Ga0466709_121466 | 3300042648 | Bacteria | 7171 |
| 51 | JGI24695J34938_10016166 | 3300002450 | Bacteria | 3806 |
| 52 | Ga0072941_1004218 | 3300005201 | Bacteria | 9368 |
| 53 | Ga0072941_1026920 | 3300005201 | Bacteria | 7386 |
| 54 | Ga0466732_113783 | 3300042656 | Bacteria | 4262 |
| 55 | Ga0466711_246502 | 3300042615 | Bacteria | 18201 |
| 56 | Ga0466711_308000 | 3300042615 | Bacteria | 8044 |
| 57 | Ga0466718_113207 | 3300042617 | Bacteria | 1577 |
| 58 | Ga0466699_089980 | 3300042597 | Bacteria | 4702 |
| 59 | Ga0466707_337010 | 3300042601 | Bacteria | 2501 |
| 60 | Ga0072941_1169544 | 3300005201 | Bacteria | 2283 |
| 61 | Ga0466705_190171 | 3300042612 | Bacteria | 5044 |
| 62 | Ga0466705_346455 | 3300042612 | Bacteria | 9013 |
| 63 | Ga0466732_186895 | 3300042656 | Bacteria | 1525 |
| 64 | Ga0466711_256530 | 3300042615 | Bacteria | 4748 |
| 65 | Ga0415639_062565 | 3300038395 | Bacteria | 9667 |
| 66 | Ga0466692_054896 | 3300042591 | Bacteria | 1791 |
| 67 | Ga0466692_163926 | 3300042591 | Bacteria | 13048 |
| 68 | Ga0466708_237730 | 3300042652 | Bacteria | 3685 |
| 69 | JGI24695J34938_10000018 | 3300002450 | Bacteria | 115524 |
| 70 | JGI24695J34938_10011465 | 3300002450 | Bacteria | 4773 |
| 71 | Ga0072941_1057900 | 3300005201 | Bacteria | 3494 |
| 72 | Ga0466732_368446 | 3300042656 | Bacteria | 1533 |
| 73 | Ga0466732_375466 | 3300042656 | Archaea | 4226 |
| 74 | Ga0466705_493779 | 3300042612 | Bacteria | 6977 |
| 75 | Ga0466712_138226 | 3300042614 | Bacteria | 2521 |
| 76 | Ga0466729_181725 | 3300042621 | Bacteria | 1688 |
| 77 | Ga0466690_426525 | 3300042590 | Bacteria | 4279 |
| 78 | Ga0466691_193627 | 3300042593 | Bacteria | 10313 |
| 79 | Ga0466720_055911 | 3300042607 | Bacteria | 20469 |
| 80 | JGI24698J34947_10000723 | 3300002449 | Bacteria | 16260 |
| 81 | JGI24698J34947_10002631 | 3300002449 | Bacteria | 9676 |
| 82 | JGI24698J34947_10016460 | 3300002449 | Bacteria | 4014 |
| 83 | JGI24698J34947_10056079 | 3300002449 | Bacteria | 1961 |
| 84 | JGI24695J34938_10014906 | 3300002450 | Bacteria | 4007 |
| 85 | Ga0072941_1010092 | 3300005201 | Bacteria | 10814 |
| 86 | Ga0466705_058967 | 3300042612 | Bacteria | 10116 |
| 87 | Ga0466712_241014 | 3300042614 | Bacteria | 2960 |
| 88 | Ga0466711_326568 | 3300042615 | Bacteria | 13182 |
| 89 | Ga0466715_066323 | 3300042616 | Bacteria | 14582 |
| 90 | Ga0123355_10008833 | 3300009826 | Bacteria | 15249 |
| 91 | Ga0123356_10007613 | 3300010049 | Bacteria | 10796 |
| 92 | Ga0123353_10323443 | 3300010167 | Bacteria | 2339 |
| 93 | Ga0415639_071533 | 3300038395 | Bacteria | 2105 |
| 94 | Ga0466696_226829 | 3300042596 | Bacteria | 1362 |
| 95 | Ga0466707_039796 | 3300042601 | Bacteria | 1406 |
| 96 | JGI24698J34947_10052011 | 3300002449 | Bacteria | 2057 |
| 97 | JGI24695J34938_10026430 | 3300002450 | Unclassified | 2759 |
| 98 | Ga0072941_1083654 | 3300005201 | Bacteria | 2327 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042612 | Ga0466705_346455 | Ga0466705_346455_6238_7101 | 258 |
| 2 | 3300005200 | Ga0072940_1031316 | Ga0072940_10313165 | 282 |
| 3 | 3300038395 | Ga0415639_062565 | Ga0415639_062565_5079_5933 | 284 |
| 4 | 3300010049 | Ga0123356_10900616 | Ga0123356_109006161 | 287 |
| 5 | 3300042596 | Ga0466696_226829 | Ga0466696_226829_207_1070 | 287 |
| 6 | 3300042648 | Ga0466709_388429 | Ga0466709_388429_8467_9330 | 287 |
| 7 | 3300042617 | Ga0466718_053727 | Ga0466718_053727_743_1609 | 288 |
| 8 | 3300042656 | Ga0466732_186895 | Ga0466732_186895_66_932 | 288 |
| 9 | 3300042656 | Ga0466732_368446 | Ga0466732_368446_432_1298 | 288 |
| 10 | 3300024493 | Ga0264413_123457 | Ga0264413_1234573 | 289 |
| 11 | 3300042636 | Ga0466703_202686 | Ga0466703_202686_1630_2499 | 289 |
| 12 | 3300042612 | Ga0466705_197331 | Ga0466705_197331_2722_3594 | 290 |
| 13 | 3300042616 | Ga0466715_630818 | Ga0466715_630818_269_1141 | 290 |
| 14 | 3300042656 | Ga0466732_113783 | Ga0466732_113783_2857_3729 | 290 |
| 15 | 3300042597 | Ga0466699_020786 | Ga0466699_020786_4406_5344 | 291 |
| 16 | 3300042620 | Ga0466728_331200 | Ga0466728_331200_4941_5816 | 291 |
| 17 | 3300038395 | Ga0415639_071533 | Ga0415639_071533_1062_1946 | 294 |
| 18 | 3300042652 | Ga0466708_166017 | Ga0466708_166017_110_1120 | 294 |
| 19 | 3300010167 | Ga0123353_10130653 | Ga0123353_101306533 | 295 |
| 20 | 3300042659 | Ga0466733_000537 | Ga0466733_000537_746_1633 | 295 |
| 21 | 3300042614 | Ga0466712_089435 | Ga0466712_089435_9925_10818 | 297 |
| 22 | 3300009826 | Ga0123355_10008833 | Ga0123355_100088334 | 298 |
| 23 | 3300042591 | Ga0466692_054896 | Ga0466692_054896_754_1686 | 298 |
| 24 | iso_pr_bacteria | 2781125691 | 2781429472 | 304 |
| 25 | 3300042597 | Ga0466699_089980 | Ga0466699_089980_1851_2789 | 305 |
| 26 | 3300042615 | Ga0466711_246502 | Ga0466711_246502_14380_15297 | 305 |
| 27 | 3300002450 | JGI24695J34938_10026430 | JGI24695J34938_100264302 | 306 |
| 28 | 3300002450 | JGI24695J34938_10026851 | JGI24695J34938_100268512 | 306 |
| 29 | 3300042593 | Ga0466691_033077 | Ga0466691_033077_1647_2567 | 306 |
| 30 | 3300002450 | JGI24695J34938_10011465 | JGI24695J34938_100114653 | 307 |
| 31 | 3300042614 | Ga0466712_138226 | Ga0466712_138226_1012_1944 | 310 |
| 32 | iso_pr_bacteria | 2781125690 | 2781427582 | 310 |
| 33 | iso_pr_bacteria | 2781125694 | 2781435194 | 310 |
| 34 | 3300002449 | JGI24698J34947_10000723 | JGI24698J34947_100007237 | 311 |
| 35 | 3300042617 | Ga0466718_046448 | Ga0466718_046448_655_1590 | 311 |
| 36 | iso_pr_bacteria | 2781125651 | 2781310662 | 311 |
| 37 | 3300002450 | JGI24695J34938_10016166 | JGI24695J34938_100161663 | 312 |
| 38 | 3300024493 | Ga0264413_100124 | Ga0264413_1001243 | 312 |
| 39 | 3300024493 | Ga0264413_107400 | Ga0264413_10740021 | 312 |
| 40 | 3300038395 | Ga0415639_015345 | Ga0415639_015345_1061_1999 | 312 |
| 41 | 3300002449 | JGI24698J34947_10056079 | JGI24698J34947_100560792 | 313 |
| 42 | 3300042590 | Ga0466690_426525 | Ga0466690_426525_1388_2329 | 313 |
| 43 | 3300042593 | Ga0466691_145105 | Ga0466691_145105_8364_9305 | 313 |
| 44 | 3300042594 | Ga0466694_318125 | Ga0466694_318125_1114_2055 | 313 |
| 45 | 3300042601 | Ga0466707_039796 | Ga0466707_039796_42_1022 | 313 |
| 46 | 3300042614 | Ga0466712_147891 | Ga0466712_147891_3300_4241 | 313 |
| 47 | 3300002449 | JGI24698J34947_10000538 | JGI24698J34947_100005389 | 314 |
| 48 | 3300002450 | JGI24695J34938_10006779 | JGI24695J34938_100067792 | 314 |
| 49 | 3300005201 | Ga0072941_1026920 | Ga0072941_10269204 | 314 |
| 50 | 3300024493 | Ga0264413_101091 | Ga0264413_1010913 | 314 |
| 51 | 3300042607 | Ga0466720_056369 | Ga0466720_056369_1420_2364 | 314 |
| 52 | 3300042616 | Ga0466715_066323 | Ga0466715_066323_10330_11274 | 314 |
| 53 | 3300042622 | Ga0466731_260203 | Ga0466731_260203_1464_2408 | 314 |
| 54 | 3300042648 | Ga0466709_121466 | Ga0466709_121466_5844_6788 | 314 |
| 55 | 3300042652 | Ga0466708_237730 | Ga0466708_237730_1361_2305 | 314 |
| 56 | iso_pr_bacteria | 2781125644 | 2781295027 | 314 |
| 57 | 3300002450 | JGI24695J34938_10004542 | JGI24695J34938_100045428 | 315 |
| 58 | 3300010167 | Ga0123353_10323443 | Ga0123353_103234433 | 315 |
| 59 | 3300042596 | Ga0466696_230252 | Ga0466696_230252_763_1710 | 315 |
| 60 | 3300042607 | Ga0466720_055911 | Ga0466720_055911_7427_8374 | 315 |
| 61 | 3300042610 | Ga0466698_042228 | Ga0466698_042228_750_1697 | 315 |
| 62 | 3300042612 | Ga0466705_441301 | Ga0466705_441301_214_1161 | 315 |
| 63 | 3300042614 | Ga0466712_241014 | Ga0466712_241014_226_1173 | 315 |
| 64 | 3300042652 | Ga0466708_169359 | Ga0466708_169359_1796_2743 | 315 |
| 65 | 3300042656 | Ga0466732_137851 | Ga0466732_137851_2161_3168 | 315 |
| 66 | 3300002449 | JGI24698J34947_10052011 | JGI24698J34947_100520112 | 316 |
| 67 | 3300002450 | JGI24695J34938_10014906 | JGI24695J34938_100149061 | 316 |
| 68 | 3300005201 | Ga0072941_1004218 | Ga0072941_10042186 | 316 |
| 69 | 3300005201 | Ga0072941_1010092 | Ga0072941_10100925 | 316 |
| 70 | 3300005201 | Ga0072941_1017575 | Ga0072941_10175753 | 316 |
| 71 | 3300005201 | Ga0072941_1041073 | Ga0072941_10410735 | 316 |
| 72 | 3300005201 | Ga0072941_1057900 | Ga0072941_10579002 | 316 |
| 73 | 3300005201 | Ga0072941_1093132 | Ga0072941_10931324 | 316 |
| 74 | 3300010049 | Ga0123356_10007613 | Ga0123356_100076134 | 316 |
| 75 | 3300010049 | Ga0123356_10044935 | Ga0123356_100449352 | 316 |
| 76 | 3300042592 | Ga0466693_032981 | Ga0466693_032981_5634_6584 | 316 |
| 77 | 3300042612 | Ga0466705_493779 | Ga0466705_493779_2164_3114 | 316 |
| 78 | 3300042656 | Ga0466732_375466 | Ga0466732_375466_1951_2901 | 316 |
| 79 | 3300042615 | Ga0466711_308000 | Ga0466711_308000_6583_7536 | 317 |
| 80 | 3300042601 | Ga0466707_337010 | Ga0466707_337010_1330_2286 | 318 |
| 81 | 3300042643 | Ga0466704_019189 | Ga0466704_019189_8518_9474 | 318 |
| 82 | 3300005201 | Ga0072941_1017576 | Ga0072941_101757610 | 319 |
| 83 | iso_pr_bacteria | 2781125681 | 2781407001 | 319 |
| 84 | 3300042643 | Ga0466704_294970 | Ga0466704_294970_407_1369 | 320 |
| 85 | 3300005201 | Ga0072941_1083654 | Ga0072941_10836541 | 321 |
| 86 | 3300042621 | Ga0466729_181725 | Ga0466729_181725_289_1254 | 321 |
| 87 | iso_pr_bacteria | 2781125632 | 2781271683 | 321 |
| 88 | iso_pr_bacteria | 650716099 | 650878565 | 321 |
| 89 | 3300002449 | JGI24698J34947_10016460 | JGI24698J34947_100164603 | 322 |
| 90 | 3300042614 | Ga0466712_106017 | Ga0466712_106017_3678_4646 | 322 |
| 91 | 3300042618 | Ga0466723_112592 | Ga0466723_112592_3525_4493 | 322 |
| 92 | iso_pr_bacteria | 2781125655 | 2781318628 | 322 |
| 93 | 3300002449 | JGI24698J34947_10002631 | JGI24698J34947_100026314 | 323 |
| 94 | 3300005201 | Ga0072941_1026918 | Ga0072941_10269184 | 323 |
| 95 | 3300042596 | Ga0466696_146595 | Ga0466696_146595_3538_4509 | 323 |
| 96 | 3300042612 | Ga0466705_190171 | Ga0466705_190171_3062_4033 | 323 |
| 97 | 3300042616 | Ga0466715_273689 | Ga0466715_273689_5046_6017 | 323 |
| 98 | 3300042616 | Ga0466715_554015 | Ga0466715_554015_2541_3512 | 323 |
| 99 | 3300005201 | Ga0072941_1169544 | Ga0072941_11695441 | 326 |
| 100 | 3300042615 | Ga0466711_256530 | Ga0466711_256530_460_1440 | 326 |
| 101 | 3300002450 | JGI24695J34938_10000018 | JGI24695J34938_100000189 | 327 |
| 102 | 3300042591 | Ga0466692_163926 | Ga0466692_163926_1928_2914 | 328 |
| 103 | 3300042617 | Ga0466718_113207 | Ga0466718_113207_293_1282 | 329 |
| 104 | 3300042615 | Ga0466711_326568 | Ga0466711_326568_9049_10050 | 333 |
| 105 | 3300042616 | Ga0466715_359806 | Ga0466715_359806_1174_2190 | 338 |
| 106 | 3300042612 | Ga0466705_058967 | Ga0466705_058967_5395_6420 | 341 |
| 107 | 3300042593 | Ga0466691_193627 | Ga0466691_193627_2261_3328 | 355 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF16811 | TAtT | TRAP transporter T-component | 91 | 351 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.76 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.