Protein Family IF04938

Metagenome Isolate
111 Members
44 Samples
105 Scaffolds
293.19 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_181114|Ga0466691_181114_2344_3288
Length
314 aa
Sequence
MLNKEIITGKNIAPATGFDPHPTPTKIGIFGSDYQAGKQNAVRELFDRLKERHTEIWVEKQFYRYLSQTFAFTPDIAGQIDSETLPLDMVFSLGGDGTFLRTAAWVGRQPIPVLGFNTGNLGFLADVSAGEIQPTLDEIFRGEYRLEEKSLLQLETTEPLPYRHALNEIAVLKRDTASMIEVAATLNDEFLTEYRADGLLLSTPTGSTAYNLSVNGPIILPASKSFVLSPVAPHSLNMRPLVIPENYKIRLRVESRNKNFLISFDGRSAVFPTGSEFLIQKADFSLKVVKRLQQSFYNTLRKKLLWGTDTRSQN

📊 Sample Types

Isolate 5.4%
Metagenome 94.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 32.6%
Termitidae 27.9%
Unclassified 14.0%
Termopsidae 9.3%
Blattidae 7.0%
Rhinotermitidae 4.7%
Passalidae 4.7%

🌳 Taxonomy

Archaea 1
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
2 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
11 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
12 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
13 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
23 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
28 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
29 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
34 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
35 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
36 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
37 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
38 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
39 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
42 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
43 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
44 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_086320 3300042612 Bacteria 10935
2 Ga0466715_239461 3300042616 Bacteria 4791
3 Ga0466723_094398 3300042618 Bacteria 5285
4 Ga0466723_178619 3300042618 Bacteria 21638
5 Ga0123356_10538962 3300010049 Bacteria 1327
6 Ga0466690_165241 3300042590 Bacteria 9329
7 Ga0466691_181114 3300042593 Bacteria 3925
8 Ga0466691_206071 3300042593 Bacteria 26570
9 Ga0466696_196899 3300042596 Archaea 5084
10 Ga0466703_188748 3300042636 Bacteria 3653
11 Ga0466703_258779 3300042636 Bacteria 8049
12 Ga0466709_128488 3300042648 Bacteria 12684
13 Ga0466715_218422 3300042616 Bacteria 20789
14 Ga0466723_142424 3300042618 Bacteria 10936
15 Ga0466726_026792 3300042619 Bacteria 7721
16 Ga0466728_053723 3300042620 Bacteria 3647
17 Ga0123353_10472936 3300010167 Bacteria 1837
18 Ga0466690_410975 3300042590 Bacteria 5454
19 Ga0466692_052308 3300042591 Unclassified 1975
20 Ga0466735_116663 3300042624 Bacteria 17397
21 Ga0466703_162080 3300042636 Bacteria 6824
22 Ga0466704_171257 3300042643 Bacteria 13166
23 Ga0466709_116198 3300042648 Bacteria 9234
24 Ga0466708_071605 3300042652 Bacteria 10063
25 Ga0466725_025030 3300042654 Bacteria 16813
26 Ga0466727_157093 3300042655 Bacteria 11119
27 Ga0466727_221985 3300042655 Bacteria 7289
28 Ga0466716_092980 3300042605 Bacteria 25359
29 Ga0466719_138260 3300042606 Bacteria 4681
30 JGI24702J35022_10000587 3300002462 Bacteria 22066
31 JGI24702J35022_10042431 3300002462 Bacteria 2423
32 JGI24702J35022_10059107 3300002462 Bacteria 2048
33 Ga0072941_1096908 3300005201 Bacteria 6905
34 Ga0466705_501789 3300042612 Unclassified 1460
35 Ga0466715_572331 3300042616 Bacteria 10909
36 Ga0123356_10146736 3300010049 Bacteria 2335
37 Ga0466692_038856 3300042591 Bacteria 66664
38 Ga0466709_106711 3300042648 Bacteria 14160
39 Ga0466725_054318 3300042654 Bacteria 16266
40 Ga0466727_169454 3300042655 Bacteria 8118
41 Ga0466713_040197 3300042602 Bacteria 1648
42 JGI24705J35276_12238552 3300002504 Bacteria 26267
43 Ga0466712_277911 3300042614 Bacteria 1146
44 Ga0466692_156027 3300042591 Bacteria 99798
45 Ga0466703_019883 3300042636 Bacteria 23097
46 Ga0466704_192304 3300042643 Bacteria 4511
47 Ga0466704_328597 3300042643 Bacteria 18009
48 Ga0466701_075893 3300042598 Bacteria 43978
49 Ga0466707_030098 3300042601 Bacteria 1075
50 Ga0466707_173612 3300042601 Bacteria 5617
51 Ga0466713_042537 3300042602 Bacteria 19077
52 Ga0466716_100304 3300042605 Bacteria 28707
53 Ga0466716_165444 3300042605 Bacteria 8783
54 Ga0466719_493982 3300042606 Bacteria 1143
55 IMNBL1DRAFT_c0000182 3300000062 Bacteria 55861
56 JGI24702J35022_10006234 3300002462 Bacteria 6909
57 Ga0072940_1286668 3300005200 Bacteria 1504
58 Ga0466728_183708 3300042620 Bacteria 10319
59 Ga0123353_10573024 3300010167 Bacteria 1622
60 Ga0466696_257847 3300042596 Bacteria 2244
61 Ga0466735_221968 3300042624 Bacteria 5109
62 Ga0466703_021232 3300042636 Bacteria 5237
63 Ga0466704_391716 3300042643 Bacteria 3684
64 Ga0466704_413829 3300042643 Bacteria 8510
65 Ga0466709_216670 3300042648 Bacteria 31600
66 Ga0466707_410055 3300042601 Bacteria 2587
67 Ga0466719_062848 3300042606 Bacteria 11457
68 Ga0466722_044078 3300042609 Bacteria 11030
69 Ga0466723_205264 3300042618 Unclassified 5427
70 Ga0466656_086426 3300042550 Bacteria 17058
71 Ga0466735_184330 3300042624 Bacteria 3156
72 Ga0466703_225656 3300042636 Bacteria 7297
73 Ga0466708_460639 3300042652 Bacteria 18491
74 Ga0466727_137368 3300042655 Bacteria 15897
75 Ga0466701_040830 3300042598 Bacteria 2723
76 Ga0466700_056215 3300042600 Bacteria 2238
77 Ga0466707_039907 3300042601 Bacteria 5174
78 Ga0466707_161945 3300042601 Bacteria 21911
79 Ga0466707_298996 3300042601 Bacteria 2274
80 Ga0466713_023492 3300042602 Bacteria 12031
81 Ga0466713_035414 3300042602 Bacteria 3797
82 Ga0466713_124643 3300042602 Bacteria 27149
83 Ga0068302_10129354 3300005071 Bacteria 6256
84 Ga0466711_048383 3300042615 Bacteria 8361
85 Ga0466715_269094 3300042616 Bacteria 6359
86 Ga0123356_10196653 3300010049 Bacteria 2052
87 Ga0123353_10119967 3300010167 Bacteria 4229
88 Ga0466735_029179 3300042624 Bacteria 8983
89 Ga0466708_093039 3300042652 Bacteria 3751
90 Ga0466708_299612 3300042652 Bacteria 12375
91 Ga0466727_204579 3300042655 Bacteria 3025
92 Ga0466722_139997 3300042609 Bacteria 1229
93 2227223883 2225789004 Bacteria 1381
94 Ga0068305_10072648 3300005083 Bacteria 7795
95 Ga0466705_064108 3300042612 Bacteria 27405
96 Ga0466733_101223 3300042659 Bacteria 57262
97 Ga0123356_10626223 3300010049 Bacteria 1242
98 Ga0466690_395845 3300042590 Bacteria 33359
99 Ga0466696_295695 3300042596 Bacteria 13583
100 Ga0466704_497510 3300042643 Bacteria 27766
101 Ga0466719_039323 3300042606 Bacteria 17178
102 IMNBL1DRAFT_c0001576 3300000062 Bacteria 16969
103 JGI24699J35502_11134231 3300002509 Bacteria 105586
104 Ga0068305_10011748 3300005083 Unclassified 10955
105 Ga0068305_10177511 3300005083 Bacteria 10537

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_204579 Ga0466727_204579_44_832 262
2 3300042616 Ga0466715_572331 Ga0466715_572331_9267_10166 266
3 3300042615 Ga0466711_048383 Ga0466711_048383_6503_7390 270
4 3300042614 Ga0466712_277911 Ga0466712_277911_311_1135 274
5 3300042609 Ga0466722_044078 Ga0466722_044078_6691_7563 280
6 3300042620 Ga0466728_053723 Ga0466728_053723_864_1754 285
7 3300002462 JGI24702J35022_10059107 JGI24702J35022_100591072 288
8 3300042602 Ga0466713_042537 Ga0466713_042537_8815_9681 288
9 3300005083 Ga0068305_10011748 Ga0068305_100117486 289
10 3300042612 Ga0466705_501789 Ga0466705_501789_478_1347 289
11 3300042636 Ga0466703_162080 Ga0466703_162080_3015_3884 289
12 3300042643 Ga0466704_497510 Ga0466704_497510_530_1399 289
13 3300042648 Ga0466709_116198 Ga0466709_116198_4254_5123 289
14 3300042652 Ga0466708_093039 Ga0466708_093039_694_1563 289
15 3300010167 Ga0123353_10119967 Ga0123353_101199673 290
16 3300010167 Ga0123353_10472936 Ga0123353_104729362 290
17 3300042590 Ga0466690_395845 Ga0466690_395845_9139_10011 290
18 3300042593 Ga0466691_206071 Ga0466691_206071_11198_12070 290
19 3300042601 Ga0466707_039907 Ga0466707_039907_865_1737 290
20 3300042601 Ga0466707_161945 Ga0466707_161945_11294_12166 290
21 3300042601 Ga0466707_173612 Ga0466707_173612_3992_4864 290
22 3300042601 Ga0466707_410055 Ga0466707_410055_1518_2390 290
23 3300042605 Ga0466716_092980 Ga0466716_092980_21233_22105 290
24 3300042605 Ga0466716_100304 Ga0466716_100304_26288_27160 290
25 3300042606 Ga0466719_138260 Ga0466719_138260_878_1750 290
26 3300042606 Ga0466719_493982 Ga0466719_493982_169_1041 290
27 3300042612 Ga0466705_064108 Ga0466705_064108_21539_22411 290
28 3300042612 Ga0466705_086320 Ga0466705_086320_4760_5632 290
29 3300042616 Ga0466715_239461 Ga0466715_239461_368_1240 290
30 3300042616 Ga0466715_269094 Ga0466715_269094_2076_2948 290
31 3300042618 Ga0466723_094398 Ga0466723_094398_3680_4552 290
32 3300042618 Ga0466723_178619 Ga0466723_178619_6703_7575 290
33 3300042636 Ga0466703_021232 Ga0466703_021232_3233_4105 290
34 3300042636 Ga0466703_188748 Ga0466703_188748_820_1692 290
35 3300042643 Ga0466704_171257 Ga0466704_171257_3709_4581 290
36 3300042643 Ga0466704_391716 Ga0466704_391716_2641_3513 290
37 3300042648 Ga0466709_128488 Ga0466709_128488_7566_8438 290
38 3300042659 Ga0466733_101223 Ga0466733_101223_10947_11819 290
39 iso_pr_bacteria 2940216256 2940217477 290
40 3300005201 Ga0072941_1096908 Ga0072941_10969089 291
41 3300010049 Ga0123356_10196653 Ga0123356_101966532 291
42 3300010049 Ga0123356_10626223 Ga0123356_106262232 291
43 3300042550 Ga0466656_086426 Ga0466656_086426_11322_12197 291
44 3300042591 Ga0466692_038856 Ga0466692_038856_49792_50667 291
45 3300042598 Ga0466701_040830 Ga0466701_040830_289_1164 291
46 3300042600 Ga0466700_056215 Ga0466700_056215_119_994 291
47 3300042602 Ga0466713_023492 Ga0466713_023492_174_1049 291
48 3300042618 Ga0466723_142424 Ga0466723_142424_1257_2132 291
49 3300042619 Ga0466726_026792 Ga0466726_026792_4155_5030 291
50 3300042643 Ga0466704_328597 Ga0466704_328597_10260_11135 291
51 3300042654 Ga0466725_025030 Ga0466725_025030_1593_2468 291
52 3300042655 Ga0466727_137368 Ga0466727_137368_9718_10593 291
53 iso_pr_bacteria 2940202316 2940204463 291
54 2225789004 2227223883 2227657835 292
55 3300002462 JGI24702J35022_10006234 JGI24702J35022_100062344 292
56 3300002504 JGI24705J35276_12238552 JGI24705J35276_1223855213 292
57 3300005071 Ga0068302_10129354 Ga0068302_101293544 292
58 3300042591 Ga0466692_156027 Ga0466692_156027_85017_85895 292
59 3300042596 Ga0466696_257847 Ga0466696_257847_1224_2102 292
60 3300042602 Ga0466713_035414 Ga0466713_035414_242_1120 292
61 3300042620 Ga0466728_183708 Ga0466728_183708_3693_4571 292
62 3300042624 Ga0466735_116663 Ga0466735_116663_3807_4685 292
63 3300042636 Ga0466703_258779 Ga0466703_258779_6066_6944 292
64 iso_pr_bacteria 2967483437 2967486857 292
65 iso_pr_bacteria 643348524 643422870 292
66 3300000062 IMNBL1DRAFT_c0001576 IMNBL1DRAFT_00015763 293
67 3300002462 JGI24702J35022_10042431 JGI24702J35022_100424314 293
68 3300042591 Ga0466692_052308 Ga0466692_052308_266_1147 293
69 3300042636 Ga0466703_225656 Ga0466703_225656_5356_6237 293
70 3300000062 IMNBL1DRAFT_c0000182 IMNBL1DRAFT_000018215 294
71 3300010049 Ga0123356_10538962 Ga0123356_105389622 294
72 3300042596 Ga0466696_295695 Ga0466696_295695_3222_4106 294
73 3300042605 Ga0466716_165444 Ga0466716_165444_5234_6118 294
74 3300042648 Ga0466709_106711 Ga0466709_106711_2827_3711 294
75 3300042652 Ga0466708_071605 Ga0466708_071605_4048_4932 294
76 3300042655 Ga0466727_157093 Ga0466727_157093_6769_7653 294
77 3300042655 Ga0466727_169454 Ga0466727_169454_3500_4384 294
78 3300042598 Ga0466701_075893 Ga0466701_075893_19543_20430 295
79 3300042602 Ga0466713_124643 Ga0466713_124643_22078_22965 295
80 3300042609 Ga0466722_139997 Ga0466722_139997_158_1045 295
81 3300042624 Ga0466735_029179 Ga0466735_029179_6409_7296 295
82 3300042624 Ga0466735_184330 Ga0466735_184330_566_1453 295
83 3300042643 Ga0466704_192304 Ga0466704_192304_144_1031 295
84 3300042648 Ga0466709_216670 Ga0466709_216670_12842_13729 295
85 3300042654 Ga0466725_054318 Ga0466725_054318_5108_5995 295
86 3300042655 Ga0466727_221985 Ga0466727_221985_3609_4496 295
87 iso_pr_bacteria 2940195863 2940198947 295
88 3300005083 Ga0068305_10177511 Ga0068305_101775118 296
89 3300010049 Ga0123356_10146736 Ga0123356_101467363 296
90 3300010167 Ga0123353_10573024 Ga0123353_105730241 296
91 3300042618 Ga0466723_205264 Ga0466723_205264_3354_4244 296
92 3300005200 Ga0072940_1286668 Ga0072940_12866682 297
93 3300042616 Ga0466715_218422 Ga0466715_218422_4808_5701 297
94 3300042652 Ga0466708_460639 Ga0466708_460639_13929_14825 298
95 3300002462 JGI24702J35022_10000587 JGI24702J35022_1000058713 299
96 3300042590 Ga0466690_165241 Ga0466690_165241_3003_3902 299
97 3300042606 Ga0466719_062848 Ga0466719_062848_3085_3984 299
98 3300042590 Ga0466690_410975 Ga0466690_410975_719_1621 300
99 3300042601 Ga0466707_298996 Ga0466707_298996_49_951 300
100 iso_pr_bacteria 2820762746 2820765107 300
101 3300002509 JGI24699J35502_11134231 JGI24699J35502_111342312 301
102 3300042624 Ga0466735_221968 Ga0466735_221968_2012_2920 302
103 3300042601 Ga0466707_030098 Ga0466707_030098_151_1065 304
104 3300042643 Ga0466704_413829 Ga0466704_413829_4734_5648 304
105 3300042652 Ga0466708_299612 Ga0466708_299612_1497_2411 304
106 3300042596 Ga0466696_196899 Ga0466696_196899_1578_2504 308
107 3300005083 Ga0068305_10072648 Ga0068305_100726485 313
108 3300042593 Ga0466691_181114 Ga0466691_181114_2344_3288 314
109 3300042602 Ga0466713_040197 Ga0466713_040197_249_1208 319
110 3300042606 Ga0466719_039323 Ga0466719_039323_4123_5100 325
111 3300042636 Ga0466703_019883 Ga0466703_019883_21594_22580 328

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20143 NAD_kinase_C ATP-NAD kinase C-terminal domain 166 290 0.95
PF01513 NAD_kinase ATP-NAD kinase N-terminal domain 27 144 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.