Protein Family IF04932

Metagenome Isolate
146 Members
41 Samples
142 Scaffolds
210.74 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_167459|Ga0466691_167459_4910_5683
Length
257 aa
Sequence
MNLFQKSRVIGRRVPYPGACSEKFTGCGKENTRELAPWSLRGFGPNDKANAQAPQAPGFFIVFCLFFTVVFAGADTFTFKADKMSGTKSLGKEVTVLAGNAEVRSDNLLLRAEKIELQGDDNQFIDCTGGVSGVEEEKEIFFQTDRLRYDRNLKIVRLEGNSSLEDRKNELVARGRFIEYDEDAEVTVFQISVRLFKDDMVCRSEYAIYRRDEKLLDLSGFPVVFKKDDEFRADRIRVDLDTDDVTMEGAVSGTIKN

📊 Sample Types

Isolate 2.7%
Metagenome 97.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.0%
Kalotermitidae 33.3%
Unclassified 12.8%
Termopsidae 7.7%
Rhinotermitidae 5.1%

🌳 Taxonomy

Archaea 0
Bacteria 129
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
9 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
15 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
16 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
17 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
28 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
35 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
36 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
39 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10008360 3300002449 Bacteria 5680
2 JGI24700J35501_10913088 3300002508 Bacteria 3734
3 Ga0072940_1028551 3300005200 Bacteria 1724
4 Ga0072941_1018183 3300005201 Bacteria 13561
5 Ga0466715_056679 3300042616 Bacteria 7310
6 Ga0466723_259470 3300042618 Bacteria 15035
7 Ga0466726_036673 3300042619 Bacteria 3785
8 Ga0466728_450943 3300042620 Bacteria 3773
9 Ga0466727_025973 3300042655 Bacteria 4305
10 Ga0466727_274563 3300042655 Bacteria 3453
11 Ga0123356_10004055 3300010049 Bacteria 15207
12 Ga0123353_10404281 3300010167 Unclassified 2031
13 Ga0264413_105871 3300024493 Unclassified 8882
14 Ga0264413_113807 3300024493 Bacteria 6422
15 Ga0466691_049059 3300042593 Bacteria 2902
16 Ga0466699_211706 3300042597 Bacteria 1667
17 Ga0466732_078386 3300042656 Bacteria 4962
18 Ga0466732_099962 3300042656 Bacteria 27941
19 Ga0466732_178103 3300042656 Bacteria 2640
20 JGI24698J34947_10012110 3300002449 Bacteria 4733
21 JGI24698J34947_10066005 3300002449 Unclassified 1762
22 Ga0072941_1005447 3300005201 Bacteria 2523
23 Ga0072941_1053332 3300005201 Bacteria 9150
24 Ga0466719_342770 3300042606 Bacteria 1634
25 Ga0466712_009227 3300042614 Bacteria 27493
26 Ga0466723_277179 3300042618 Unclassified 3608
27 Ga0466726_171990 3300042619 Bacteria 2252
28 Ga0466729_140982 3300042621 Bacteria 4169
29 Ga0466735_114114 3300042624 Bacteria 1517
30 Ga0466703_119488 3300042636 Bacteria 16381
31 Ga0466708_014496 3300042652 Bacteria 11641
32 Ga0466727_119843 3300042655 Bacteria 2599
33 Ga0466696_011300 3300042596 Bacteria 1794
34 Ga0466696_117170 3300042596 Bacteria 10079
35 Ga0466732_013759 3300042656 Bacteria 5713
36 JGI24698J34947_10053637 3300002449 Bacteria 2017
37 JGI24698J34947_10062188 3300002449 Bacteria 1834
38 JGI24695J34938_10000312 3300002450 Bacteria 48010
39 Ga0466700_305694 3300042600 Bacteria 2543
40 Ga0466707_042544 3300042601 Bacteria 1377
41 Ga0466719_021371 3300042606 Bacteria 3244
42 Ga0466719_161698 3300042606 Bacteria 6995
43 Ga0466711_082314 3300042615 Bacteria 15048
44 Ga0466715_307992 3300042616 Bacteria 19266
45 Ga0466723_217966 3300042618 Bacteria 58279
46 Ga0466728_108887 3300042620 Bacteria 19171
47 Ga0466728_386367 3300042620 Bacteria 2519
48 Ga0466729_082796 3300042621 Bacteria 1523
49 Ga0466708_155385 3300042652 Bacteria 20713
50 Ga0466690_137111 3300042590 Bacteria 4280
51 Ga0466694_263752 3300042594 Bacteria 11563
52 Ga0466732_286468 3300042656 Bacteria 4128
53 JGI24695J34938_10074074 3300002450 Bacteria 1417
54 Ga0072941_1094934 3300005201 Bacteria 3452
55 Ga0466707_378841 3300042601 Bacteria 1417
56 Ga0466712_054577 3300042614 Bacteria 2296
57 Ga0466712_270477 3300042614 Unclassified 1683
58 Ga0466712_278704 3300042614 Unclassified 2265
59 Ga0466712_319777 3300042614 Bacteria 3790
60 Ga0466715_054597 3300042616 Bacteria 9400
61 Ga0466723_131034 3300042618 Bacteria 7476
62 Ga0466723_161004 3300042618 Bacteria 4304
63 Ga0466735_026118 3300042624 Bacteria 1418
64 Ga0466702_142393 3300042635 Bacteria 1395
65 Ga0466708_336065 3300042652 Bacteria 1460
66 Ga0123356_11036671 3300010049 Bacteria 990
67 Ga0466691_167459 3300042593 Bacteria 6522
68 Ga0466694_190199 3300042594 Bacteria 1020
69 Ga0466732_452543 3300042656 Unclassified 2009
70 AustNasuHG_c1007365 3300000089 Bacteria 3917
71 JGI24698J34947_10020590 3300002449 Unclassified 3551
72 JGI24698J34947_10129335 3300002449 Bacteria 1082
73 JGI24695J34938_10030645 3300002450 Bacteria 2503
74 Ga0072941_1003572 3300005201 Bacteria 38999
75 Ga0466720_053175 3300042607 Bacteria 7154
76 Ga0466720_119821 3300042607 Bacteria 22326
77 Ga0466722_240272 3300042609 Bacteria 1958
78 Ga0466712_236957 3300042614 Bacteria 1420
79 Ga0466715_411752 3300042616 Bacteria 6519
80 Ga0466715_515432 3300042616 Bacteria 4668
81 Ga0466718_102600 3300042617 Bacteria 17725
82 Ga0466718_156218 3300042617 Bacteria 1497
83 Ga0466735_086522 3300042624 Bacteria 1646
84 Ga0466708_347870 3300042652 Unclassified 2257
85 Ga0123356_10979658 3300010049 Bacteria 1016
86 Ga0123353_10099915 3300010167 Bacteria 4676
87 AustNasuHG_c1001457 3300000089 Bacteria 8487
88 JGI24698J34947_10040007 3300002449 Bacteria 2424
89 JGI24702J35022_10009872 3300002462 Bacteria 5349
90 Ga0466719_230241 3300042606 Bacteria 5352
91 Ga0466719_323035 3300042606 Unclassified 2691
92 Ga0466720_156019 3300042607 Bacteria 55009
93 Ga0466722_098359 3300042609 Bacteria 8223
94 Ga0466712_001726 3300042614 Bacteria 1374
95 Ga0466711_020200 3300042615 Bacteria 1792
96 Ga0466718_049821 3300042617 Bacteria 16731
97 Ga0466723_091625 3300042618 Bacteria 45311
98 Ga0466726_112945 3300042619 Bacteria 3298
99 Ga0466735_207182 3300042624 Bacteria 1469
100 Ga0466735_235761 3300042624 Bacteria 1638
101 Ga0466703_048884 3300042636 Bacteria 1025
102 Ga0466704_556490 3300042643 Unclassified 9507
103 Ga0466694_338186 3300042594 Bacteria 1276
104 Ga0466705_013545 3300042612 Bacteria 34726
105 AustNasuHG_c1016091 3300000089 Bacteria 2509
106 JGI24698J34947_10028717 3300002449 Bacteria 2944
107 JGI24698J34947_10032547 3300002449 Bacteria 2737
108 Ga0072940_1028550 3300005200 Bacteria 1599
109 Ga0072940_1029483 3300005200 Bacteria 4989
110 Ga0072941_1088034 3300005201 Unclassified 3000
111 Ga0466705_500351 3300042612 Bacteria 5302
112 Ga0466712_104446 3300042614 Bacteria 2035
113 Ga0466712_176269 3300042614 Bacteria 2775
114 Ga0466711_466883 3300042615 Bacteria 3610
115 Ga0466715_049424 3300042616 Bacteria 22983
116 Ga0466718_036935 3300042617 Bacteria 1398
117 Ga0466723_122113 3300042618 Bacteria 2355
118 Ga0466726_049170 3300042619 Bacteria 3814
119 Ga0466729_154315 3300042621 Bacteria 2192
120 Ga0466704_025536 3300042643 Bacteria 1862
121 Ga0466727_317027 3300042655 Unclassified 2304
122 Ga0466690_151698 3300042590 Unclassified 1814
123 Ga0466699_229634 3300042597 Bacteria 1869
124 JGI24698J34947_10040221 3300002449 Bacteria 2415
125 JGI24698J34947_10063317 3300002449 Bacteria 1813
126 JGI24698J34947_10187292 3300002449 Unclassified 822
127 Ga0072940_1034211 3300005200 Unclassified 4766
128 Ga0466716_080549 3300042605 Bacteria 1998
129 Ga0466719_097957 3300042606 Bacteria 9149
130 Ga0466719_440447 3300042606 Bacteria 1883
131 Ga0466720_156820 3300042607 Bacteria 42318
132 Ga0466712_131056 3300042614 Bacteria 5269
133 Ga0466712_202924 3300042614 Bacteria 1088
134 Ga0466718_077322 3300042617 Bacteria 31469
135 Ga0466726_136866 3300042619 Bacteria 2418
136 Ga0466729_267593 3300042621 Bacteria 1465
137 Ga0466704_075647 3300042643 Bacteria 38985
138 Ga0466704_436704 3300042643 Bacteria 9755
139 Ga0264413_118397 3300024493 Bacteria 8722
140 Ga0466690_299408 3300042590 Unclassified 2652
141 Ga0466699_325633 3300042597 Bacteria 1574
142 Ga0466699_443203 3300042597 Bacteria 2141

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_137111 Ga0466690_137111_2668_3288 206
2 3300042590 Ga0466690_151698 Ga0466690_151698_436_1056 206
3 3300042593 Ga0466691_049059 Ga0466691_049059_1462_2082 206
4 3300042596 Ga0466696_011300 Ga0466696_011300_790_1410 206
5 3300042596 Ga0466696_117170 Ga0466696_117170_2765_3385 206
6 3300042597 Ga0466699_443203 Ga0466699_443203_531_1151 206
7 3300042606 Ga0466719_230241 Ga0466719_230241_3305_3925 206
8 3300042614 Ga0466712_009227 Ga0466712_009227_960_1580 206
9 3300042614 Ga0466712_236957 Ga0466712_236957_654_1274 206
10 3300042614 Ga0466712_270477 Ga0466712_270477_934_1554 206
11 3300042614 Ga0466712_278704 Ga0466712_278704_1353_1973 206
12 3300042614 Ga0466712_319777 Ga0466712_319777_2492_3112 206
13 3300042615 Ga0466711_466883 Ga0466711_466883_293_913 206
14 3300042616 Ga0466715_049424 Ga0466715_049424_9226_9846 206
15 3300042616 Ga0466715_054597 Ga0466715_054597_6606_7226 206
16 3300042616 Ga0466715_515432 Ga0466715_515432_2448_3068 206
17 3300042617 Ga0466718_049821 Ga0466718_049821_10320_10940 206
18 3300042618 Ga0466723_122113 Ga0466723_122113_295_915 206
19 3300042618 Ga0466723_161004 Ga0466723_161004_1024_1644 206
20 3300042618 Ga0466723_259470 Ga0466723_259470_10112_10732 206
21 3300042618 Ga0466723_277179 Ga0466723_277179_1360_1980 206
22 3300042620 Ga0466728_386367 Ga0466728_386367_1023_1643 206
23 3300042624 Ga0466735_235761 Ga0466735_235761_116_736 206
24 3300042635 Ga0466702_142393 Ga0466702_142393_24_644 206
25 3300042636 Ga0466703_048884 Ga0466703_048884_68_688 206
26 3300042643 Ga0466704_025536 Ga0466704_025536_398_1018 206
27 3300042643 Ga0466704_556490 Ga0466704_556490_7720_8340 206
28 3300042652 Ga0466708_014496 Ga0466708_014496_10138_10758 206
29 3300042652 Ga0466708_155385 Ga0466708_155385_14112_14732 206
30 3300042655 Ga0466727_119843 Ga0466727_119843_1100_1720 206
31 3300042655 Ga0466727_317027 Ga0466727_317027_587_1207 206
32 3300002449 JGI24698J34947_10020590 JGI24698J34947_100205904 207
33 3300002449 JGI24698J34947_10063317 JGI24698J34947_100633173 207
34 3300002449 JGI24698J34947_10066005 JGI24698J34947_100660052 207
35 3300002450 JGI24695J34938_10000312 JGI24695J34938_1000031216 207
36 3300005200 Ga0072940_1029483 Ga0072940_10294833 207
37 3300005200 Ga0072940_1034211 Ga0072940_10342115 207
38 3300005201 Ga0072941_1003572 Ga0072941_10035723 207
39 3300005201 Ga0072941_1005447 Ga0072941_10054473 207
40 3300010049 Ga0123356_10004055 Ga0123356_1000405515 207
41 3300010049 Ga0123356_10979658 Ga0123356_109796582 207
42 3300024493 Ga0264413_118397 Ga0264413_11839711 207
43 3300042594 Ga0466694_190199 Ga0466694_190199_174_797 207
44 3300042594 Ga0466694_338186 Ga0466694_338186_137_760 207
45 3300042597 Ga0466699_325633 Ga0466699_325633_616_1239 207
46 3300042600 Ga0466700_305694 Ga0466700_305694_1796_2419 207
47 3300042606 Ga0466719_161698 Ga0466719_161698_377_1051 207
48 3300042609 Ga0466722_098359 Ga0466722_098359_6104_6727 207
49 3300042609 Ga0466722_240272 Ga0466722_240272_516_1139 207
50 3300042614 Ga0466712_054577 Ga0466712_054577_1353_1976 207
51 3300042616 Ga0466715_411752 Ga0466715_411752_2649_3272 207
52 3300042619 Ga0466726_171990 Ga0466726_171990_739_1362 207
53 3300042620 Ga0466728_450943 Ga0466728_450943_2202_2825 207
54 3300042621 Ga0466729_267593 Ga0466729_267593_480_1103 207
55 3300042652 Ga0466708_336065 Ga0466708_336065_204_827 207
56 3300042652 Ga0466708_347870 Ga0466708_347870_1431_2054 207
57 3300042655 Ga0466727_025973 Ga0466727_025973_2289_2912 207
58 iso_pr_bacteria 2819994798 2819995005 207
59 3300002449 JGI24698J34947_10008360 JGI24698J34947_100083603 208
60 3300002449 JGI24698J34947_10012110 JGI24698J34947_100121102 208
61 3300002449 JGI24698J34947_10032547 JGI24698J34947_100325473 208
62 3300002449 JGI24698J34947_10040007 JGI24698J34947_100400072 208
63 3300002449 JGI24698J34947_10040221 JGI24698J34947_100402212 208
64 3300002449 JGI24698J34947_10129335 JGI24698J34947_101293352 208
65 3300002449 JGI24698J34947_10187292 JGI24698J34947_101872921 208
66 3300002508 JGI24700J35501_10913088 JGI24700J35501_109130886 208
67 3300042597 Ga0466699_211706 Ga0466699_211706_329_955 208
68 3300042597 Ga0466699_229634 Ga0466699_229634_557_1183 208
69 3300042607 Ga0466720_156820 Ga0466720_156820_6430_7056 208
70 3300042612 Ga0466705_500351 Ga0466705_500351_2036_2662 208
71 3300042614 Ga0466712_104446 Ga0466712_104446_753_1379 208
72 3300042614 Ga0466712_131056 Ga0466712_131056_1671_2297 208
73 3300042614 Ga0466712_176269 Ga0466712_176269_1415_2041 208
74 3300042614 Ga0466712_202924 Ga0466712_202924_409_1035 208
75 3300042619 Ga0466726_049170 Ga0466726_049170_1117_1743 208
76 3300042656 Ga0466732_178103 Ga0466732_178103_27_653 208
77 iso_pr_bacteria 2781125689 2781426076 208
78 iso_pr_bacteria 2781125696 2781440850 208
79 3300002449 JGI24698J34947_10028717 JGI24698J34947_100287173 209
80 3300002449 JGI24698J34947_10053637 JGI24698J34947_100536373 209
81 3300002449 JGI24698J34947_10062188 JGI24698J34947_100621882 209
82 3300002450 JGI24695J34938_10074074 JGI24695J34938_100740742 209
83 3300002462 JGI24702J35022_10009872 JGI24702J35022_100098724 209
84 3300005201 Ga0072941_1088034 Ga0072941_10880344 209
85 3300010049 Ga0123356_11036671 Ga0123356_110366712 209
86 3300024493 Ga0264413_105871 Ga0264413_1058714 209
87 3300024493 Ga0264413_113807 Ga0264413_1138073 209
88 3300042594 Ga0466694_263752 Ga0466694_263752_4234_4863 209
89 3300042607 Ga0466720_053175 Ga0466720_053175_3502_4131 209
90 3300042607 Ga0466720_119821 Ga0466720_119821_2497_3126 209
91 3300042614 Ga0466712_001726 Ga0466712_001726_677_1306 209
92 3300042618 Ga0466723_091625 Ga0466723_091625_39052_39681 209
93 3300042656 Ga0466732_286468 Ga0466732_286468_2000_2629 209
94 iso_pr_bacteria 2781125683 2781411660 209
95 3300005200 Ga0072940_1028550 Ga0072940_10285503 210
96 3300005200 Ga0072940_1028551 Ga0072940_10285512 210
97 3300005201 Ga0072941_1094934 Ga0072941_10949342 210
98 3300042605 Ga0466716_080549 Ga0466716_080549_848_1480 210
99 3300042615 Ga0466711_020200 Ga0466711_020200_595_1227 210
100 3300042617 Ga0466718_036935 Ga0466718_036935_93_725 210
101 3300042617 Ga0466718_102600 Ga0466718_102600_13458_14090 210
102 3300042617 Ga0466718_156218 Ga0466718_156218_160_792 210
103 3300042621 Ga0466729_082796 Ga0466729_082796_24_656 210
104 3300042621 Ga0466729_140982 Ga0466729_140982_2430_3062 210
105 3300042656 Ga0466732_078386 Ga0466732_078386_2552_3184 210
106 3300042656 Ga0466732_099962 Ga0466732_099962_20888_21520 210
107 3300042601 Ga0466707_042544 Ga0466707_042544_167_820 211
108 3300042656 Ga0466732_013759 Ga0466732_013759_4767_5402 211
109 3300005201 Ga0072941_1018183 Ga0072941_101818312 212
110 3300010167 Ga0123353_10404281 Ga0123353_104042812 212
111 3300042619 Ga0466726_036673 Ga0466726_036673_696_1334 212
112 3300042624 Ga0466735_026118 Ga0466735_026118_34_672 212
113 3300000089 AustNasuHG_c1001457 AustNasuHG_10014575 213
114 3300000089 AustNasuHG_c1007365 AustNasuHG_10073654 213
115 3300042606 Ga0466719_021371 Ga0466719_021371_2065_2706 213
116 3300042621 Ga0466729_154315 Ga0466729_154315_365_1006 213
117 3300000089 AustNasuHG_c1016091 AustNasuHG_10160913 214
118 3300005201 Ga0072941_1053332 Ga0072941_10533327 214
119 3300042606 Ga0466719_097957 Ga0466719_097957_3297_3941 214
120 3300042606 Ga0466719_323035 Ga0466719_323035_2015_2659 214
121 3300042606 Ga0466719_440447 Ga0466719_440447_1207_1851 214
122 3300042617 Ga0466718_077322 Ga0466718_077322_2234_2878 214
123 3300042618 Ga0466723_217966 Ga0466723_217966_11586_12230 214
124 3300002450 JGI24695J34938_10030645 JGI24695J34938_100306452 215
125 3300042601 Ga0466707_378841 Ga0466707_378841_136_783 215
126 3300042615 Ga0466711_082314 Ga0466711_082314_2657_3304 215
127 3300042624 Ga0466735_114114 Ga0466735_114114_698_1345 215
128 3300042624 Ga0466735_207182 Ga0466735_207182_662_1309 215
129 3300042656 Ga0466732_452543 Ga0466732_452543_813_1460 215
130 3300042619 Ga0466726_112945 Ga0466726_112945_676_1326 216
131 3300042620 Ga0466728_108887 Ga0466728_108887_999_1649 216
132 3300042624 Ga0466735_086522 Ga0466735_086522_744_1397 217
133 3300010167 Ga0123353_10099915 Ga0123353_100999153 218
134 3300042616 Ga0466715_056679 Ga0466715_056679_2858_3514 218
135 3300042606 Ga0466719_342770 Ga0466719_342770_620_1279 219
136 3300042619 Ga0466726_136866 Ga0466726_136866_1016_1681 221
137 3300042643 Ga0466704_436704 Ga0466704_436704_7937_8614 225
138 3300042590 Ga0466690_299408 Ga0466690_299408_926_1606 226
139 3300042612 Ga0466705_013545 Ga0466705_013545_19507_20187 226
140 3300042616 Ga0466715_307992 Ga0466715_307992_16167_16847 226
141 3300042643 Ga0466704_075647 Ga0466704_075647_2545_3225 226
142 3300042655 Ga0466727_274563 Ga0466727_274563_2463_3143 226
143 3300042618 Ga0466723_131034 Ga0466723_131034_299_994 231
144 3300042636 Ga0466703_119488 Ga0466703_119488_9223_9951 242
145 3300042607 Ga0466720_156019 Ga0466720_156019_22081_22830 249
146 3300042593 Ga0466691_167459 Ga0466691_167459_4910_5683 257

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13100 OstA_2 OstA-like protein 80 212 0.9
PF03968 LptD_N LptA/(LptD N-terminal domain) LPS transport protein 91 185 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.