Protein Family IF04929

Metagenome Isolate
136 Members
58 Samples
126 Scaffolds
311.65 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_162398|Ga0466691_162398_227_1273
Length
348 aa
Sequence
VVLDWVPKTTPQDTASREPYRHDDKGWIFVSKRKLLSIVVPTYNEELNVVPLSKAIVCEIEKSLPQYDYEIIFIDNFSIDHTRALIADICRINKKIKAIFNARNFGAVNSGVYGLCQSTGDCTILLNADFQDPIEMIPVLVKEWENGYKIVSAIKTTSKENKFVRFLRTCYYKLIRKMSEDVEQIEHFTGFGLYDKEFIDVLRQLDDSQPFLRGIVAELGPRRKDIPYQQQKRRAGKSTYNWYRYYDIAMLGFTSYTKIGMRLATILGFIISLCSIAIGLVYLVLKLTNWDAFPTGSAPILIGVFVLGGLQIFFIGLAGEYILNINSRIMKRPLVVEERRINFDEPSP

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.3%
Kalotermitidae 25.0%
Unclassified 14.3%
Blattidae 7.1%
Rhinotermitidae 5.4%
Termopsidae 5.4%
Hodotermitidae 1.8%
Passalidae 1.8%

🌳 Taxonomy

Archaea 1
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820004052 Unclassified Synergistetes Nt197P3bin25 Isolate Unclassified
2 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
17 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
27 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
28 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
29 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
39 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
40 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
47 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
48 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
49 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
50 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
52 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
53 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
54 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
55 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
56 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
57 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
58 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_287910 3300042599 Bacteria 14097
2 Ga0466719_186636 3300042606 Bacteria 2058
3 Ga0123355_10000180 3300009826 Bacteria 77979
4 Ga0123356_10002210 3300010049 Bacteria 20938
5 Ga0466723_091106 3300042618 Bacteria 2468
6 Ga0466723_185666 3300042618 Bacteria 15931
7 Ga0466728_046183 3300042620 Bacteria 22842
8 Ga0466735_097045 3300042624 Bacteria 9135
9 Ga0466702_048759 3300042635 Bacteria 1841
10 Ga0466708_290632 3300042652 Bacteria 5775
11 AustNasuHG_c1008466 3300000089 Unclassified 3638
12 Ga0068302_10520043 3300005071 Unclassified 1628
13 Ga0466706_052327 3300042599 Bacteria 8254
14 Ga0466720_018719 3300042607 Unclassified 3001
15 Ga0466722_021301 3300042609 Bacteria 6222
16 Ga0123355_10000666 3300009826 Bacteria 46536
17 Ga0123355_10006641 3300009826 Bacteria 17181
18 Ga0123356_10034023 3300010049 Bacteria 4766
19 Ga0123356_10046240 3300010049 Bacteria 4049
20 Ga0123356_10173598 3300010049 Bacteria 2169
21 Ga0123356_10521731 3300010049 Bacteria 1346
22 Ga0466711_440895 3300042615 Bacteria 2285
23 Ga0466718_091988 3300042617 Unclassified 10107
24 Ga0466726_151452 3300042619 Bacteria 1474
25 Ga0466728_104057 3300042620 Bacteria 17641
26 Ga0415639_183290 3300038395 Bacteria 3159
27 Ga0466690_163291 3300042590 Bacteria 7579
28 Ga0466699_152973 3300042597 Bacteria 7288
29 Ga0466731_411674 3300042622 Bacteria 5182
30 Ga0466702_432230 3300042635 Bacteria 3193
31 Ga0466703_146085 3300042636 Bacteria 2600
32 Ga0466704_269891 3300042643 Bacteria 69200
33 Ga0466705_295862 3300042612 Bacteria 10981
34 Ga0466733_017424 3300042659 Bacteria 26015
35 Ga0466733_205813 3300042659 Bacteria 3348
36 2227166925 2225789004 Bacteria 8292
37 AustNasuHG_c1011736 3300000089 Bacteria 3034
38 JGI24698J34947_10007689 3300002449 Bacteria 5920
39 JGI24695J34938_10003444 3300002450 Bacteria 11048
40 JGI24699J35502_11102889 3300002509 Bacteria 2417
41 Ga0068305_10002964 3300005083 Bacteria 33952
42 Ga0466722_212251 3300042609 Bacteria 9267
43 Ga0123355_10109331 3300009826 Bacteria 4324
44 Ga0123353_10002433 3300010167 Bacteria 23134
45 Ga0466715_207234 3300042616 Bacteria 35424
46 Ga0466715_505560 3300042616 Bacteria 2342
47 Ga0466690_411935 3300042590 Bacteria 19362
48 Ga0466691_162398 3300042593 Bacteria 9269
49 Ga0466732_331438 3300042656 Bacteria 28230
50 Ga0466706_115591 3300042599 Bacteria 30125
51 Ga0466706_231754 3300042599 Bacteria 9520
52 Ga0466716_297253 3300042605 Bacteria 2983
53 Ga0466721_035301 3300042608 Bacteria 11030
54 Ga0123356_10000062 3300010049 Bacteria 112695
55 Ga0123356_10344171 3300010049 Bacteria 1613
56 Ga0123353_10214693 3300010167 Bacteria 3014
57 Ga0466705_416322 3300042612 Bacteria 2185
58 Ga0466712_022395 3300042614 Unclassified 2107
59 Ga0466728_046477 3300042620 Bacteria 4632
60 Ga0466728_066222 3300042620 Bacteria 9733
61 Ga0466690_133899 3300042590 Bacteria 17989
62 Ga0466731_048131 3300042622 Bacteria 17747
63 Ga0466702_396121 3300042635 Bacteria 1400
64 Ga0466703_027689 3300042636 Bacteria 31024
65 Ga0466704_018797 3300042643 Bacteria 55333
66 Ga0466704_204091 3300042643 Bacteria 16068
67 Ga0466705_322723 3300042612 Bacteria 9646
68 Ga0466732_194882 3300042656 Unclassified 1711
69 JGI24698J34947_10002059 3300002449 Bacteria 10746
70 JGI24698J34947_10015784 3300002449 Bacteria 4108
71 Ga0068305_10007844 3300005083 Bacteria 14505
72 Ga0072941_1176014 3300005201 Bacteria 3343
73 Ga0466713_029009 3300042602 Bacteria 31538
74 Ga0123353_10000329 3300010167 Bacteria 58569
75 Ga0466715_370575 3300042616 Bacteria 24804
76 Ga0466718_075881 3300042617 Bacteria 13965
77 Ga0466696_045345 3300042596 Bacteria 5640
78 Ga0466708_104150 3300042652 Bacteria 29160
79 JGI24702J35022_10021116 3300002462 Bacteria 3533
80 JGI24696J40584_12961154 3300002834 Bacteria 11386
81 Ga0072940_1294824 3300005200 Archaea 1568
82 Ga0072941_1047344 3300005201 Bacteria 5191
83 Ga0466706_065494 3300042599 Bacteria 27814
84 Ga0466700_132237 3300042600 Bacteria 1464
85 Ga0466713_095358 3300042602 Bacteria 22885
86 Ga0466713_124947 3300042602 Bacteria 1782
87 Ga0123355_10000018 3300009826 Bacteria 155505
88 Ga0123355_10014679 3300009826 Bacteria 12264
89 Ga0123355_10164479 3300009826 Bacteria 3333
90 Ga0123355_10652697 3300009826 Bacteria 1227
91 Ga0123356_10037122 3300010049 Unclassified 4547
92 Ga0123353_10174790 3300010167 Bacteria 3406
93 Ga0466723_071847 3300042618 Bacteria 22986
94 Ga0466728_298652 3300042620 Bacteria 3085
95 Ga0466699_046742 3300042597 Unclassified 15155
96 Ga0466703_224451 3300042636 Bacteria 6068
97 Ga0466703_353112 3300042636 Bacteria 2185
98 Ga0466704_560172 3300042643 Bacteria 2199
99 Ga0466709_116551 3300042648 Bacteria 44112
100 Ga0466705_206629 3300042612 Bacteria 11905
101 2227461363 2225789004 Bacteria 5349
102 2227507959 2225789004 Bacteria 65570
103 AustNasuHG_c1002796 3300000089 Bacteria 6306
104 JGI24698J34947_10034786 3300002449 Unclassified 2634
105 Ga0466720_022415 3300042607 Bacteria 22736
106 Ga0123356_10056174 3300010049 Bacteria 3667
107 Ga0466715_078593 3300042616 Bacteria 1589
108 Ga0466723_154928 3300042618 Bacteria 7721
109 Ga0466692_199822 3300042591 Unclassified 12610
110 Ga0466699_163112 3300042597 Bacteria 3805
111 Ga0466731_375346 3300042622 Bacteria 3140
112 Ga0466735_086755 3300042624 Bacteria 3724
113 Ga0466703_152245 3300042636 Bacteria 7029
114 Ga0466704_538691 3300042643 Bacteria 2179
115 Ga0466709_415858 3300042648 Bacteria 3788
116 Ga0068305_10155159 3300005083 Bacteria 1867
117 Ga0466706_131732 3300042599 Bacteria 1433
118 Ga0466711_410792 3300042615 Unclassified 5254
119 Ga0264413_129263 3300024493 Bacteria 13573
120 Ga0264413_135732 3300024493 Bacteria 3405
121 Ga0466696_031063 3300042596 Bacteria 1043
122 Ga0466729_202269 3300042621 Bacteria 4611
123 Ga0466729_311769 3300042621 Unclassified 2319
124 Ga0466730_068103 3300042625 Bacteria 7335
125 Ga0466702_274631 3300042635 Bacteria 1708
126 Ga0466704_290361 3300042643 Bacteria 3983

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_151452 Ga0466726_151452_630_1463 277
2 3300042617 Ga0466718_091988 Ga0466718_091988_1120_2055 279
3 3300042605 Ga0466716_297253 Ga0466716_297253_1969_2901 280
4 3300042618 Ga0466723_154928 Ga0466723_154928_71_922 283
5 iso_pr_bacteria 2781125635 2781277809 285
6 3300042643 Ga0466704_538691 Ga0466704_538691_1057_1995 292
7 3300024493 Ga0264413_135732 Ga0264413_1357325 293
8 3300000089 AustNasuHG_c1008466 AustNasuHG_10084663 294
9 3300009826 Ga0123355_10000666 Ga0123355_1000066621 294
10 3300042616 Ga0466715_505560 Ga0466715_505560_1178_2062 294
11 3300042636 Ga0466703_027689 Ga0466703_027689_1216_2148 294
12 3300042590 Ga0466690_411935 Ga0466690_411935_654_1598 295
13 3300042616 Ga0466715_078593 Ga0466715_078593_242_1177 295
14 3300002449 JGI24698J34947_10002059 JGI24698J34947_1000205914 296
15 3300042624 Ga0466735_086755 Ga0466735_086755_2696_3646 296
16 3300042643 Ga0466704_560172 Ga0466704_560172_543_1475 296
17 3300002449 JGI24698J34947_10015784 JGI24698J34947_100157846 298
18 3300042624 Ga0466735_097045 Ga0466735_097045_1477_2430 298
19 3300042635 Ga0466702_048759 Ga0466702_048759_258_1193 298
20 3300042636 Ga0466703_146085 Ga0466703_146085_645_1577 299
21 3300042659 Ga0466733_205813 Ga0466733_205813_19_960 299
22 3300005083 Ga0068305_10155159 Ga0068305_101551591 300
23 3300010049 Ga0123356_10000062 Ga0123356_1000006220 300
24 3300042652 Ga0466708_104150 Ga0466708_104150_13604_14566 301
25 3300005071 Ga0068302_10520043 Ga0068302_105200432 303
26 3300005200 Ga0072940_1294824 Ga0072940_12948242 303
27 3300042620 Ga0466728_298652 Ga0466728_298652_2032_2991 303
28 3300042597 Ga0466699_152973 Ga0466699_152973_2307_3224 305
29 3300010167 Ga0123353_10214693 Ga0123353_102146933 306
30 3300042615 Ga0466711_410792 Ga0466711_410792_4302_5222 306
31 3300010167 Ga0123353_10000329 Ga0123353_1000032917 307
32 3300042622 Ga0466731_375346 Ga0466731_375346_401_1324 307
33 3300042622 Ga0466731_411674 Ga0466731_411674_2804_3727 307
34 3300042609 Ga0466722_021301 Ga0466722_021301_789_1718 309
35 3300042620 Ga0466728_066222 Ga0466728_066222_6939_7868 309
36 3300042621 Ga0466729_311769 Ga0466729_311769_1247_2191 309
37 iso_pr_bacteria 2820600392 2820600548 309
38 3300005201 Ga0072941_1176014 Ga0072941_11760142 310
39 3300009826 Ga0123355_10000180 Ga0123355_1000018066 310
40 3300042591 Ga0466692_199822 Ga0466692_199822_3081_4013 310
41 3300042596 Ga0466696_031063 Ga0466696_031063_98_1030 310
42 3300042597 Ga0466699_046742 Ga0466699_046742_12827_13759 310
43 3300042599 Ga0466706_115591 Ga0466706_115591_16542_17474 310
44 3300042599 Ga0466706_131732 Ga0466706_131732_84_1016 310
45 3300042600 Ga0466700_132237 Ga0466700_132237_75_1007 310
46 3300042602 Ga0466713_095358 Ga0466713_095358_16295_17227 310
47 3300042602 Ga0466713_124947 Ga0466713_124947_144_1076 310
48 3300042606 Ga0466719_186636 Ga0466719_186636_198_1130 310
49 3300042607 Ga0466720_018719 Ga0466720_018719_1144_2076 310
50 3300042607 Ga0466720_022415 Ga0466720_022415_18494_19426 310
51 3300042612 Ga0466705_322723 Ga0466705_322723_3641_4573 310
52 3300042618 Ga0466723_071847 Ga0466723_071847_20793_21725 310
53 3300042620 Ga0466728_046183 Ga0466728_046183_15958_16890 310
54 3300042635 Ga0466702_396121 Ga0466702_396121_94_1026 310
55 3300042636 Ga0466703_353112 Ga0466703_353112_299_1231 310
56 3300042643 Ga0466704_290361 Ga0466704_290361_647_1579 310
57 3300042652 Ga0466708_290632 Ga0466708_290632_1645_2577 310
58 3300042656 Ga0466732_194882 Ga0466732_194882_288_1220 310
59 3300042659 Ga0466733_017424 Ga0466733_017424_5015_5947 310
60 3300000089 AustNasuHG_c1002796 AustNasuHG_10027963 311
61 3300000089 AustNasuHG_c1011736 AustNasuHG_10117363 311
62 3300002834 JGI24696J40584_12961154 JGI24696J40584_129611548 311
63 3300005083 Ga0068305_10007844 Ga0068305_1000784411 311
64 3300009826 Ga0123355_10164479 Ga0123355_101644792 311
65 3300010049 Ga0123356_10056174 Ga0123356_100561742 311
66 3300010049 Ga0123356_10521731 Ga0123356_105217312 311
67 3300042612 Ga0466705_206629 Ga0466705_206629_4826_5761 311
68 3300042612 Ga0466705_295862 Ga0466705_295862_7983_8918 311
69 3300042612 Ga0466705_416322 Ga0466705_416322_829_1764 311
70 3300042618 Ga0466723_185666 Ga0466723_185666_10620_11555 311
71 3300042643 Ga0466704_018797 Ga0466704_018797_5393_6328 311
72 3300042648 Ga0466709_415858 Ga0466709_415858_151_1086 311
73 iso_pr_bacteria 2820004052 2820004966 311
74 iso_pr_bacteria 2820424542 2820424961 311
75 3300009826 Ga0123355_10000018 Ga0123355_10000018108 312
76 3300010049 Ga0123356_10002210 Ga0123356_100022102 312
77 3300010167 Ga0123353_10174790 Ga0123353_101747903 312
78 3300038395 Ga0415639_183290 Ga0415639_183290_772_1710 312
79 3300042608 Ga0466721_035301 Ga0466721_035301_280_1218 312
80 3300042618 Ga0466723_091106 Ga0466723_091106_850_1788 312
81 3300010049 Ga0123356_10037122 Ga0123356_100371222 313
82 3300042620 Ga0466728_046477 Ga0466728_046477_2369_3310 313
83 3300010049 Ga0123356_10034023 Ga0123356_100340233 314
84 3300010049 Ga0123356_10173598 Ga0123356_101735982 314
85 3300042643 Ga0466704_204091 Ga0466704_204091_11258_12202 314
86 3300010049 Ga0123356_10344171 Ga0123356_103441712 315
87 3300042590 Ga0466690_163291 Ga0466690_163291_2950_3897 315
88 3300042599 Ga0466706_052327 Ga0466706_052327_6251_7198 315
89 iso_pr_bacteria 2940277027 2940279504 315
90 iso_pr_bacteria 2940289514 2940291894 315
91 iso_pr_bacteria 2940292506 2940294922 315
92 iso_pr_bacteria 2940295490 2940297892 315
93 2225789004 2227461363 2227896443 316
94 2225789004 2227507959 2227998778 316
95 3300010049 Ga0123356_10046240 Ga0123356_100462401 316
96 3300010167 Ga0123353_10002433 Ga0123353_100024336 316
97 3300042609 Ga0466722_212251 Ga0466722_212251_179_1168 317
98 3300009826 Ga0123355_10014679 Ga0123355_100146798 318
99 3300042597 Ga0466699_163112 Ga0466699_163112_65_1021 318
100 3300042620 Ga0466728_104057 Ga0466728_104057_6317_7273 318
101 3300002462 JGI24702J35022_10021116 JGI24702J35022_100211162 319
102 3300002509 JGI24699J35502_11102889 JGI24699J35502_111028893 319
103 3300009826 Ga0123355_10006641 Ga0123355_1000664110 319
104 3300042614 Ga0466712_022395 Ga0466712_022395_1019_1978 319
105 3300042615 Ga0466711_440895 Ga0466711_440895_837_1796 319
106 3300042616 Ga0466715_370575 Ga0466715_370575_20688_21647 319
107 3300042636 Ga0466703_152245 Ga0466703_152245_4529_5488 319
108 3300042636 Ga0466703_224451 Ga0466703_224451_4804_5763 319
109 2225789004 2227166925 2227579597 320
110 3300002449 JGI24698J34947_10007689 JGI24698J34947_100076892 320
111 3300002449 JGI24698J34947_10034786 JGI24698J34947_100347864 320
112 3300042596 Ga0466696_045345 Ga0466696_045345_286_1248 320
113 3300042621 Ga0466729_202269 Ga0466729_202269_3591_4553 320
114 3300042635 Ga0466702_432230 Ga0466702_432230_1638_2600 320
115 iso_pr_bacteria 2820255904 2820255924 320
116 iso_pr_bacteria 2820535361 2820535960 320
117 3300009826 Ga0123355_10109331 Ga0123355_101093314 321
118 3300042635 Ga0466702_274631 Ga0466702_274631_143_1108 321
119 3300042656 Ga0466732_331438 Ga0466732_331438_26013_26978 321
120 3300005201 Ga0072941_1047344 Ga0072941_10473444 322
121 3300024493 Ga0264413_129263 Ga0264413_1292635 322
122 3300002450 JGI24695J34938_10003444 JGI24695J34938_100034446 324
123 3300009826 Ga0123355_10652697 Ga0123355_106526971 324
124 3300042622 Ga0466731_048131 Ga0466731_048131_1951_2925 324
125 3300042599 Ga0466706_065494 Ga0466706_065494_18219_19250 325
126 3300042617 Ga0466718_075881 Ga0466718_075881_11213_12193 326
127 3300042599 Ga0466706_231754 Ga0466706_231754_57_1046 329
128 3300042599 Ga0466706_287910 Ga0466706_287910_10029_11021 330
129 3300042602 Ga0466713_029009 Ga0466713_029009_11234_12241 335
130 3300042616 Ga0466715_207234 Ga0466715_207234_21063_22070 335
131 3300042625 Ga0466730_068103 Ga0466730_068103_3825_4832 335
132 3300042643 Ga0466704_269891 Ga0466704_269891_31421_32428 335
133 3300042648 Ga0466709_116551 Ga0466709_116551_14371_15378 335
134 3300005083 Ga0068305_10002964 Ga0068305_1000296418 336
135 3300042590 Ga0466690_133899 Ga0466690_133899_103_1128 341
136 3300042593 Ga0466691_162398 Ga0466691_162398_227_1273 348

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00535 Glycos_transf_2 Glycosyl transferase family 2 37 187 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.