Protein Family IF04917

Metagenome Isolate
180 Members
53 Samples
175 Scaffolds
178.26 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_135882|Ga0466691_135882_4993_5550
Length
171 aa
Sequence
MKKTEIRSTTVLAVRKGETVMKNNARKVRRLMDGKVLCGFAGATADAFTLFDLFEVKLKEYSGDLLRAAVELAKEWRTDRTLRRLEALLLVADLQKTLLISGTGDVIEPAEDALAIGSVGNYAYAAALAYLEGSAFSAAEIAEKSLKIAGNICIYTNSQIMLEELPSKEKK

📊 Sample Types

Isolate 2.8%
Metagenome 97.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 49.0%
Kalotermitidae 25.5%
Unclassified 11.8%
Rhinotermitidae 7.8%
Termopsidae 5.9%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
2 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
3 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
7 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
15 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
16 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
17 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
18 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
19 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
37 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
38 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
39 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
45 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
46 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
49 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
50 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
51 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
52 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
53 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_048766 3300042598 Bacteria 1009
2 Ga0123356_10621953 3300010049 Bacteria 1246
3 Ga0123353_10572514 3300010167 Bacteria 1623
4 Ga0466712_236565 3300042614 Unclassified 2576
5 Ga0466711_193862 3300042615 Bacteria 9562
6 Ga0466718_067635 3300042617 Bacteria 12512
7 Ga0466723_007155 3300042618 Bacteria 25180
8 Ga0466723_010757 3300042618 Bacteria 43976
9 Ga0466723_025859 3300042618 Bacteria 2961
10 Ga0466723_219676 3300042618 Bacteria 5369
11 Ga0466692_113556 3300042591 Bacteria 3003
12 Ga0466702_112422 3300042635 Bacteria 1218
13 Ga0466702_168042 3300042635 Bacteria 8611
14 Ga0466702_248651 3300042635 Bacteria 1865
15 Ga0466704_429340 3300042643 Bacteria 3296
16 Ga0466709_082090 3300042648 Bacteria 9773
17 JGI24698J34947_10000394 3300002449 Bacteria 19780
18 JGI24698J34947_10005671 3300002449 Bacteria 6844
19 JGI24698J34947_10082872 3300002449 Unclassified 1498
20 JGI24695J34938_10004258 3300002450 Bacteria 9483
21 JGI24695J34938_10007275 3300002450 Bacteria 6520
22 JGI24695J34938_10071660 3300002450 Unclassified 1447
23 JGI24702J35022_10015386 3300002462 Bacteria 4211
24 Ga0072941_1014212 3300005201 Bacteria 4675
25 Ga0466705_331486 3300042612 Bacteria 57655
26 Ga0466705_361907 3300042612 Bacteria 9484
27 Ga0466719_396187 3300042606 Bacteria 33459
28 Ga0123356_10966049 3300010049 Bacteria 1022
29 Ga0264413_100302 3300024493 Bacteria 69754
30 Ga0466704_119001 3300042643 Unclassified 5160
31 JGI24698J34947_10004001 3300002449 Bacteria 8011
32 JGI24695J34938_10000443 3300002450 Bacteria 40027
33 JGI24695J34938_10003560 3300002450 Bacteria 10753
34 Ga0068305_10007620 3300005083 Bacteria 27204
35 Ga0072941_1023895 3300005201 Bacteria 2716
36 Ga0123356_10901800 3300010049 Bacteria 1055
37 Ga0123354_10193484 3300010882 Bacteria 2267
38 Ga0466712_056807 3300042614 Bacteria 31023
39 Ga0466711_133683 3300042615 Bacteria 7748
40 Ga0466715_151023 3300042616 Bacteria 2119
41 Ga0466718_057050 3300042617 Bacteria 9839
42 Ga0466723_252499 3300042618 Bacteria 5108
43 Ga0466723_318016 3300042618 Bacteria 5583
44 Ga0466690_338507 3300042590 Bacteria 1037
45 Ga0466690_428259 3300042590 Bacteria 3223
46 Ga0466691_135882 3300042593 Bacteria 15999
47 Ga0466696_423932 3300042596 Bacteria 1953
48 Ga0466699_192350 3300042597 Bacteria 3395
49 Ga0466699_318342 3300042597 Bacteria 12632
50 Ga0466699_381781 3300042597 Bacteria 1426
51 Ga0466702_123023 3300042635 Unclassified 1727
52 Ga0466702_190237 3300042635 Bacteria 3351
53 JGI24698J34947_10009913 3300002449 Bacteria 5224
54 JGI24695J34938_10001567 3300002450 Bacteria 19252
55 JGI24695J34938_10002604 3300002450 Bacteria 13574
56 JGI24699J35502_10869190 3300002509 Unclassified 987
57 Ga0072941_1014211 3300005201 Bacteria 2943
58 Ga0466705_306579 3300042612 Bacteria 11644
59 Ga0466719_561114 3300042606 Bacteria 23121
60 Ga0466722_082964 3300042609 Bacteria 56291
61 Ga0123357_10104382 3300009784 Bacteria 3640
62 Ga0123357_10417612 3300009784 Bacteria 1201
63 Ga0123357_10485729 3300009784 Bacteria 1039
64 Ga0123355_10001757 3300009826 Bacteria 30298
65 Ga0123356_10000340 3300010049 Bacteria 53881
66 Ga0123356_11955630 3300010049 Bacteria 731
67 Ga0466715_062281 3300042616 Bacteria 4085
68 Ga0466715_511523 3300042616 Unclassified 2007
69 Ga0466718_063941 3300042617 Bacteria 16372
70 Ga0466726_205724 3300042619 Bacteria 1345
71 Ga0466728_039246 3300042620 Bacteria 29985
72 Ga0264413_101133 3300024493 Bacteria 21360
73 Ga0264413_116430 3300024493 Bacteria 3141
74 Ga0415639_075221 3300038395 Bacteria 4085
75 Ga0466690_130546 3300042590 Unclassified 1475
76 Ga0466690_286538 3300042590 Unclassified 3994
77 Ga0466692_060516 3300042591 Bacteria 1515
78 Ga0466694_006499 3300042594 Bacteria 16001
79 Ga0466699_263910 3300042597 Bacteria 1435
80 Ga0466702_314993 3300042635 Bacteria 1373
81 Ga0466702_370629 3300042635 Bacteria 1677
82 Ga0466709_075195 3300042648 Bacteria 10461
83 Ga0466708_023929 3300042652 Bacteria 2828
84 JGI24695J34938_10000389 3300002450 Bacteria 43422
85 Ga0072941_1005300 3300005201 Bacteria 3231
86 Ga0466716_305369 3300042605 Bacteria 6589
87 Ga0466720_073458 3300042607 Unclassified 2585
88 Ga0466722_048606 3300042609 Bacteria 3467
89 Ga0123355_10083363 3300009826 Bacteria 5096
90 Ga0123356_10031373 3300010049 Bacteria 4972
91 Ga0466712_066647 3300042614 Bacteria 1804
92 Ga0466712_240514 3300042614 Bacteria 1621
93 Ga0466711_254994 3300042615 Bacteria 26854
94 Ga0466718_145267 3300042617 Bacteria 15591
95 Ga0264413_101386 3300024493 Bacteria 7783
96 Ga0466690_396657 3300042590 Bacteria 14185
97 Ga0466693_166031 3300042592 Bacteria 4977
98 Ga0466691_202144 3300042593 Bacteria 37125
99 Ga0466691_216720 3300042593 Bacteria 10264
100 Ga0466694_192488 3300042594 Bacteria 1725
101 Ga0466696_200248 3300042596 Bacteria 15331
102 Ga0466699_007369 3300042597 Bacteria 4278
103 Ga0466731_058799 3300042622 Bacteria 1854
104 Ga0466735_003565 3300042624 Bacteria 4456
105 Ga0466702_002572 3300042635 Bacteria 1195
106 Ga0466708_017458 3300042652 Bacteria 16555
107 Ga0466708_156829 3300042652 Bacteria 1226
108 Ga0466727_037371 3300042655 Bacteria 1853
109 Ga0466727_166955 3300042655 Bacteria 1441
110 2230969590 2228664004 Bacteria 27562
111 AustNasuHG_c1000911 3300000089 Bacteria 10667
112 JGI24698J34947_10020894 3300002449 Bacteria 3525
113 JGI24698J34947_10056762 3300002449 Bacteria 1945
114 JGI24695J34938_10000132 3300002450 Bacteria 67814
115 JGI24702J35022_10043082 3300002462 Bacteria 2403
116 Ga0466700_452536 3300042600 Bacteria 1020
117 Ga0466717_019932 3300042604 Bacteria 1193
118 Ga0466720_022531 3300042607 Bacteria 1979
119 Ga0123356_10021995 3300010049 Bacteria 6022
120 Ga0466712_019495 3300042614 Bacteria 40574
121 Ga0466711_094440 3300042615 Bacteria 6872
122 Ga0466718_000332 3300042617 Bacteria 25424
123 Ga0466718_030996 3300042617 Bacteria 12488
124 Ga0466723_063398 3300042618 Bacteria 10197
125 Ga0466726_145230 3300042619 Bacteria 3637
126 Ga0466690_095471 3300042590 Bacteria 57449
127 Ga0466693_251991 3300042592 Bacteria 12964
128 Ga0466694_281202 3300042594 Bacteria 5294
129 Ga0466699_019486 3300042597 Bacteria 6799
130 Ga0466735_228260 3300042624 Unclassified 1673
131 Ga0466702_434840 3300042635 Bacteria 1236
132 Ga0466704_218475 3300042643 Bacteria 1466
133 Ga0466708_217537 3300042652 Bacteria 33917
134 JGI24698J34947_10050838 3300002449 Unclassified 2088
135 JGI24698J34947_10066652 3300002449 Unclassified 1751
136 JGI24695J34938_10000140 3300002450 Bacteria 65738
137 JGI24695J34938_10002664 3300002450 Bacteria 13316
138 Ga0072941_1014210 3300005201 Bacteria 33023
139 Ga0072941_1066532 3300005201 Bacteria 2675
140 Ga0466719_024469 3300042606 Unclassified 1464
141 Ga0466698_176121 3300042610 Bacteria 1900
142 Ga0466698_372630 3300042610 Bacteria 2167
143 Ga0123353_10335125 3300010167 Bacteria 2288
144 Ga0123353_10446945 3300010167 Bacteria 1905
145 Ga0466712_184649 3300042614 Bacteria 13172
146 Ga0466715_392245 3300042616 Bacteria 49927
147 Ga0466718_100884 3300042617 Bacteria 2043
148 Ga0466726_277869 3300042619 Bacteria 6351
149 Ga0456237_0007744 3300041968 Bacteria 1646
150 Ga0466695_006127 3300042595 Bacteria 69665
151 Ga0466699_322674 3300042597 Bacteria 75586
152 Ga0466735_061951 3300042624 Unclassified 2914
153 Ga0466704_049139 3300042643 Bacteria 37521
154 Ga0466708_055260 3300042652 Bacteria 1762
155 Ga0466727_343274 3300042655 Bacteria 2154
156 JGI24698J34947_10059620 3300002449 Bacteria 1886
157 JGI24698J34947_10098203 3300002449 Unclassified 1324
158 JGI24695J34938_10035250 3300002450 Unclassified 2289
159 Ga0466720_014617 3300042607 Bacteria 13721
160 Ga0466720_032036 3300042607 Bacteria 49795
161 Ga0466722_127760 3300042609 Bacteria 1783
162 Ga0123357_10139761 3300009784 Unclassified 2981
163 Ga0123353_11410118 3300010167 Bacteria 895
164 Ga0466726_031246 3300042619 Bacteria 1775
165 Ga0264413_128494 3300024493 Bacteria 1467
166 Ga0415639_072203 3300038395 Bacteria 3694
167 Ga0466694_406717 3300042594 Bacteria 27989
168 Ga0466696_152207 3300042596 Bacteria 33378
169 Ga0466699_404786 3300042597 Bacteria 1547
170 Ga0466729_297680 3300042621 Bacteria 1339
171 Ga0466729_305618 3300042621 Unclassified 1756
172 Ga0466702_271913 3300042635 Bacteria 11478
173 Ga0466702_322364 3300042635 Bacteria 1027
174 JGI24695J34938_10002193 3300002450 Bacteria 15232
175 Ga0072941_1015472 3300005201 Bacteria 21539

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002450 JGI24695J34938_10002193 JGI24695J34938_100021938 167
2 3300002450 JGI24695J34938_10002664 JGI24695J34938_100026646 167
3 3300042591 Ga0466692_060516 Ga0466692_060516_655_1203 167
4 3300042617 Ga0466718_000332 Ga0466718_000332_11407_11946 167
5 3300042617 Ga0466718_030996 Ga0466718_030996_5472_6011 167
6 3300042617 Ga0466718_063941 Ga0466718_063941_5530_6069 167
7 3300042617 Ga0466718_067635 Ga0466718_067635_5498_6037 167
8 3300042635 Ga0466702_002572 Ga0466702_002572_122_667 167
9 3300042635 Ga0466702_123023 Ga0466702_123023_723_1262 167
10 3300042635 Ga0466702_168042 Ga0466702_168042_4879_5424 167
11 3300042635 Ga0466702_370629 Ga0466702_370629_247_786 167
12 3300002450 JGI24695J34938_10000132 JGI24695J34938_1000013228 168
13 3300002450 JGI24695J34938_10000140 JGI24695J34938_1000014043 168
14 3300002450 JGI24695J34938_10001567 JGI24695J34938_100015677 168
15 3300002450 JGI24695J34938_10002604 JGI24695J34938_1000260412 168
16 3300002450 JGI24695J34938_10071660 JGI24695J34938_100716602 168
17 3300024493 Ga0264413_100302 Ga0264413_10030211 168
18 3300042590 Ga0466690_286538 Ga0466690_286538_1960_2505 168
19 3300042594 Ga0466694_006499 Ga0466694_006499_9959_10498 168
20 3300042594 Ga0466694_281202 Ga0466694_281202_3860_4399 168
21 3300042607 Ga0466720_032036 Ga0466720_032036_37074_37580 168
22 3300042617 Ga0466718_057050 Ga0466718_057050_8406_8945 168
23 3300042618 Ga0466723_007155 Ga0466723_007155_14699_15244 168
24 3300042635 Ga0466702_190237 Ga0466702_190237_2295_2840 168
25 3300042635 Ga0466702_271913 Ga0466702_271913_5525_6064 168
26 3300042635 Ga0466702_322364 Ga0466702_322364_429_974 168
27 3300042635 Ga0466702_434840 Ga0466702_434840_101_646 168
28 3300002450 JGI24695J34938_10000443 JGI24695J34938_1000044310 169
29 3300002450 JGI24695J34938_10003560 JGI24695J34938_100035609 169
30 3300010049 Ga0123356_10000340 Ga0123356_1000034014 169
31 3300042614 Ga0466712_056807 Ga0466712_056807_22706_23248 169
32 3300042614 Ga0466712_236565 Ga0466712_236565_1557_2099 169
33 3300042635 Ga0466702_112422 Ga0466702_112422_463_1008 169
34 3300042635 Ga0466702_248651 Ga0466702_248651_641_1195 169
35 2228664004 2230969590 2230682700 170
36 3300002449 JGI24698J34947_10005671 JGI24698J34947_100056717 170
37 3300002449 JGI24698J34947_10050838 JGI24698J34947_100508382 170
38 3300002449 JGI24698J34947_10066652 JGI24698J34947_100666522 170
39 3300002449 JGI24698J34947_10082872 JGI24698J34947_100828722 170
40 3300002449 JGI24698J34947_10098203 JGI24698J34947_100982032 170
41 3300002450 JGI24695J34938_10000389 JGI24695J34938_1000038922 170
42 3300002450 JGI24695J34938_10007275 JGI24695J34938_100072752 170
43 3300002509 JGI24699J35502_10869190 JGI24699J35502_108691901 170
44 3300010049 Ga0123356_10901800 Ga0123356_109018002 170
45 3300024493 Ga0264413_101133 Ga0264413_1011332 170
46 3300024493 Ga0264413_101386 Ga0264413_1013863 170
47 3300038395 Ga0415639_075221 Ga0415639_075221_989_1531 170
48 3300042607 Ga0466720_014617 Ga0466720_014617_12717_13262 170
49 3300042607 Ga0466720_022531 Ga0466720_022531_1249_1794 170
50 3300042610 Ga0466698_372630 Ga0466698_372630_840_1385 170
51 3300042614 Ga0466712_066647 Ga0466712_066647_1156_1701 170
52 3300042621 Ga0466729_297680 Ga0466729_297680_298_846 170
53 3300042635 Ga0466702_314993 Ga0466702_314993_94_639 170
54 3300042652 Ga0466708_023929 Ga0466708_023929_1425_1937 170
55 3300002449 JGI24698J34947_10020894 JGI24698J34947_100208942 171
56 3300002449 JGI24698J34947_10056762 JGI24698J34947_100567622 171
57 3300002450 JGI24695J34938_10004258 JGI24695J34938_100042583 171
58 3300005201 Ga0072941_1014210 Ga0072941_101421032 171
59 3300005201 Ga0072941_1014211 Ga0072941_10142113 171
60 3300005201 Ga0072941_1014212 Ga0072941_10142123 171
61 3300005201 Ga0072941_1015472 Ga0072941_101547217 171
62 3300024493 Ga0264413_116430 Ga0264413_1164304 171
63 3300042593 Ga0466691_135882 Ga0466691_135882_4993_5550 171
64 3300042597 Ga0466699_019486 Ga0466699_019486_4488_5036 171
65 3300005201 Ga0072941_1066532 Ga0072941_10665324 172
66 3300042624 Ga0466735_061951 Ga0466735_061951_1765_2316 172
67 3300042594 Ga0466694_192488 Ga0466694_192488_372_920 173
68 3300042619 Ga0466726_205724 Ga0466726_205724_25_570 173
69 3300042595 Ga0466695_006127 Ga0466695_006127_17701_18258 174
70 3300042622 Ga0466731_058799 Ga0466731_058799_139_684 174
71 3300010049 Ga0123356_10031373 Ga0123356_100313732 175
72 3300042605 Ga0466716_305369 Ga0466716_305369_2626_3171 176
73 3300042598 Ga0466701_048766 Ga0466701_048766_132_665 177
74 3300042592 Ga0466693_166031 Ga0466693_166031_2535_3071 178
75 3300010049 Ga0123356_11955630 Ga0123356_119556301 179
76 3300042590 Ga0466690_130546 Ga0466690_130546_363_902 179
77 3300042597 Ga0466699_322674 Ga0466699_322674_67856_68395 179
78 3300042618 Ga0466723_025859 Ga0466723_025859_2403_2942 179
79 3300042618 Ga0466723_252499 Ga0466723_252499_1308_1847 179
80 3300042643 Ga0466704_429340 Ga0466704_429340_2578_3117 179
81 iso_pr_bacteria 2781125655 2781317628 179
82 3300009826 Ga0123355_10001757 Ga0123355_1000175719 180
83 3300038395 Ga0415639_072203 Ga0415639_072203_1659_2222 180
84 3300042606 Ga0466719_024469 Ga0466719_024469_766_1308 180
85 3300042612 Ga0466705_361907 Ga0466705_361907_7165_7707 180
86 3300042616 Ga0466715_511523 Ga0466715_511523_932_1474 180
87 3300042620 Ga0466728_039246 Ga0466728_039246_20358_20900 180
88 3300042643 Ga0466704_119001 Ga0466704_119001_3807_4349 180
89 3300002449 JGI24698J34947_10004001 JGI24698J34947_100040018 181
90 3300005201 Ga0072941_1005300 Ga0072941_10053003 181
91 3300010167 Ga0123353_10335125 Ga0123353_103351252 181
92 3300010167 Ga0123353_11410118 Ga0123353_114101182 181
93 3300042590 Ga0466690_338507 Ga0466690_338507_281_826 181
94 3300042590 Ga0466690_428259 Ga0466690_428259_1377_1922 181
95 3300042592 Ga0466693_251991 Ga0466693_251991_9733_10278 181
96 3300042596 Ga0466696_152207 Ga0466696_152207_4901_5446 181
97 3300042597 Ga0466699_192350 Ga0466699_192350_2656_3201 181
98 3300042597 Ga0466699_263910 Ga0466699_263910_36_581 181
99 3300042597 Ga0466699_318342 Ga0466699_318342_7908_8453 181
100 3300042606 Ga0466719_396187 Ga0466719_396187_13222_13767 181
101 3300042612 Ga0466705_331486 Ga0466705_331486_36542_37087 181
102 3300042614 Ga0466712_019495 Ga0466712_019495_2730_3275 181
103 3300042614 Ga0466712_184649 Ga0466712_184649_5817_6362 181
104 3300042615 Ga0466711_193862 Ga0466711_193862_730_1275 181
105 3300042616 Ga0466715_392245 Ga0466715_392245_19346_19891 181
106 3300042617 Ga0466718_145267 Ga0466718_145267_4431_4976 181
107 3300042618 Ga0466723_010757 Ga0466723_010757_13240_13785 181
108 3300042618 Ga0466723_318016 Ga0466723_318016_1733_2278 181
109 3300042648 Ga0466709_082090 Ga0466709_082090_8029_8574 181
110 3300042655 Ga0466727_343274 Ga0466727_343274_1305_1850 181
111 iso_pr_bacteria 2781125639 2781286445 181
112 3300002449 JGI24698J34947_10000394 JGI24698J34947_1000039415 182
113 3300002449 JGI24698J34947_10009913 JGI24698J34947_100099136 182
114 3300002449 JGI24698J34947_10059620 JGI24698J34947_100596202 182
115 3300002450 JGI24695J34938_10035250 JGI24695J34938_100352502 182
116 3300009784 Ga0123357_10417612 Ga0123357_104176122 182
117 3300009784 Ga0123357_10485729 Ga0123357_104857292 182
118 3300009826 Ga0123355_10083363 Ga0123355_100833632 182
119 3300010049 Ga0123356_10621953 Ga0123356_106219532 182
120 3300010049 Ga0123356_10966049 Ga0123356_109660492 182
121 3300010882 Ga0123354_10193484 Ga0123354_101934841 182
122 3300041968 Ga0456237_0007744 Ga0456237_0007744_261_809 182
123 3300042590 Ga0466690_095471 Ga0466690_095471_35899_36447 182
124 3300042593 Ga0466691_202144 Ga0466691_202144_15814_16362 182
125 3300042597 Ga0466699_404786 Ga0466699_404786_401_949 182
126 3300042600 Ga0466700_452536 Ga0466700_452536_215_763 182
127 3300042610 Ga0466698_176121 Ga0466698_176121_1025_1573 182
128 3300042614 Ga0466712_240514 Ga0466712_240514_297_845 182
129 3300042618 Ga0466723_063398 Ga0466723_063398_5914_6462 182
130 3300005201 Ga0072941_1023895 Ga0072941_10238952 183
131 3300010167 Ga0123353_10572514 Ga0123353_105725142 183
132 3300042597 Ga0466699_381781 Ga0466699_381781_76_627 183
133 3300042607 Ga0466720_073458 Ga0466720_073458_1970_2521 183
134 3300042609 Ga0466722_127760 Ga0466722_127760_889_1467 183
135 3300042615 Ga0466711_254994 Ga0466711_254994_16212_16763 183
136 3300042617 Ga0466718_100884 Ga0466718_100884_307_858 183
137 3300042621 Ga0466729_305618 Ga0466729_305618_623_1174 183
138 3300042624 Ga0466735_228260 Ga0466735_228260_330_881 183
139 iso_pr_bacteria 650716099 650878607 183
140 3300009784 Ga0123357_10104382 Ga0123357_101043823 184
141 3300009784 Ga0123357_10139761 Ga0123357_101397612 184
142 3300010049 Ga0123356_10021995 Ga0123356_100219952 184
143 3300024493 Ga0264413_128494 Ga0264413_1284942 184
144 3300042590 Ga0466690_396657 Ga0466690_396657_4291_4845 184
145 3300042594 Ga0466694_406717 Ga0466694_406717_11915_12469 184
146 3300042596 Ga0466696_200248 Ga0466696_200248_10206_10760 184
147 3300042612 Ga0466705_306579 Ga0466705_306579_2120_2674 184
148 3300042643 Ga0466704_049139 Ga0466704_049139_24711_25265 184
149 iso_pr_bacteria 2781125697 2781443524 184
150 3300002462 JGI24702J35022_10015386 JGI24702J35022_100153866 185
151 3300002462 JGI24702J35022_10043082 JGI24702J35022_100430823 185
152 3300042604 Ga0466717_019932 Ga0466717_019932_533_1090 185
153 3300042643 Ga0466704_218475 Ga0466704_218475_726_1283 185
154 3300042652 Ga0466708_017458 Ga0466708_017458_1250_1807 185
155 3300000089 AustNasuHG_c1000911 AustNasuHG_10009116 186
156 3300042609 Ga0466722_082964 Ga0466722_082964_33290_33850 186
157 3300042619 Ga0466726_031246 Ga0466726_031246_622_1182 186
158 3300005083 Ga0068305_10007620 Ga0068305_1000762018 187
159 3300042596 Ga0466696_423932 Ga0466696_423932_573_1136 187
160 3300042597 Ga0466699_007369 Ga0466699_007369_2232_2795 187
161 3300042648 Ga0466709_075195 Ga0466709_075195_5821_6384 187
162 3300042652 Ga0466708_156829 Ga0466708_156829_239_802 187
163 3300042655 Ga0466727_037371 Ga0466727_037371_184_747 187
164 3300042655 Ga0466727_166955 Ga0466727_166955_224_787 187
165 3300042619 Ga0466726_145230 Ga0466726_145230_2961_3533 190
166 3300042619 Ga0466726_277869 Ga0466726_277869_2983_3555 190
167 3300042606 Ga0466719_561114 Ga0466719_561114_1551_2126 191
168 3300042615 Ga0466711_133683 Ga0466711_133683_5605_6180 191
169 3300042618 Ga0466723_219676 Ga0466723_219676_56_631 191
170 3300042652 Ga0466708_217537 Ga0466708_217537_24232_24807 191
171 iso_pr_bacteria 2781125666 2781344695 191
172 3300010167 Ga0123353_10446945 Ga0123353_104469452 192
173 3300042609 Ga0466722_048606 Ga0466722_048606_395_973 192
174 3300042591 Ga0466692_113556 Ga0466692_113556_1471_2052 193
175 3300042616 Ga0466715_062281 Ga0466715_062281_3488_4069 193
176 3300042624 Ga0466735_003565 Ga0466735_003565_515_1096 193
177 3300042616 Ga0466715_151023 Ga0466715_151023_1177_1761 194
178 3300042652 Ga0466708_055260 Ga0466708_055260_414_1013 199
179 3300042593 Ga0466691_216720 Ga0466691_216720_2243_2869 208
180 3300042615 Ga0466711_094440 Ga0466711_094440_5137_5793 212

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00227 Proteasome Proteasome subunit 11 162 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.34 0.39 Low

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.