Protein Family IF04910

Metagenome Isolate
112 Members
31 Samples
110 Scaffolds
465.33 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_125507|Ga0466691_125507_26289_27896
Length
509 aa
Sequence
MCRPGGRLGAYTEGGAKAAVNAGARGKAGRENLPPHAPACHRNIAKSLIFRHLIGMILSEFDVWYRTRYRRTSSSLTTTAFVLSDLLGVMLSFGWGFFWVNLYDFSIINFKSFVTYWPYLPVFILIFQILNLYPGISLAPAEELRRFSIGSFMAHGGIILSRFIEDQDWDSISLAFIVSFVFSTTILLTMRSVTHWLLHKTRLGGIPAVIYGSGATGGIEEYRGIPVIHDTGAGPEIVKRYNIKMAIVAMPQLDSGKLKKLLNDSVSAFRYNVLIPHFFSVTNIWMSVRDFNGVLGFVTSHKLKMPWNLGIKRFMDIFIAVFGGLLVLPLLLLIAALIKLSSPGPVLYGHKRLGKNGGHFTAYKFRSMVTDSAERLEKLLERDPEIRREWETNRKLRNDPRVTKIGRFLRRTSFDEFPQLINVLKGEMSLIGPRPIVDAEIEKYGENYSRVFSVLPGLTGLWQVSGRSDKGYNDRVSYDTYYLQSWSVWLDLWVLFKTFGVVIKGKGAY

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 46.7%
Termitidae 30.0%
Rhinotermitidae 10.0%
Unclassified 6.7%
Termopsidae 6.7%

🌳 Taxonomy

Archaea 1
Bacteria 110
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
18 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
19 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
27 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
28 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
29 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466723_054937 3300042618 Bacteria 13929
2 Ga0466728_155905 3300042620 Bacteria 3076
3 Ga0466728_444536 3300042620 Bacteria 12054
4 Ga0466703_011948 3300042636 Bacteria 11530
5 Ga0466703_082492 3300042636 Bacteria 4160
6 Ga0466704_236061 3300042643 Unclassified 7173
7 Ga0466709_000526 3300042648 Bacteria 10476
8 Ga0466709_383559 3300042648 Bacteria 4631
9 Ga0466708_102129 3300042652 Bacteria 3714
10 Ga0466727_068955 3300042655 Bacteria 2294
11 Ga0466727_204838 3300042655 Bacteria 6181
12 Ga0466727_310093 3300042655 Bacteria 3013
13 JGI24695J34938_10058095 3300002450 Bacteria 1660
14 Ga0466692_029512 3300042591 Bacteria 12775
15 Ga0466692_111092 3300042591 Bacteria 21683
16 Ga0466692_169671 3300042591 Bacteria 2129
17 Ga0466691_214205 3300042593 Bacteria 5223
18 Ga0466694_342275 3300042594 Bacteria 17413
19 Ga0466705_055972 3300042612 Bacteria 8603
20 Ga0466705_266113 3300042612 Bacteria 67009
21 Ga0466715_289814 3300042616 Bacteria 2678
22 Ga0466703_232830 3300042636 Bacteria 8389
23 Ga0466703_255550 3300042636 Bacteria 14185
24 Ga0466708_141296 3300042652 Bacteria 14270
25 JGI24695J34938_10004053 3300002450 Bacteria 9816
26 Ga0466698_410570 3300042610 Bacteria 2476
27 Ga0456237_0008062 3300041968 Bacteria 1606
28 Ga0466690_020146 3300042590 Bacteria 7693
29 Ga0466692_137360 3300042591 Bacteria 11462
30 Ga0466705_207657 3300042612 Bacteria 8189
31 Ga0466705_246027 3300042612 Bacteria 50897
32 Ga0466703_236604 3300042636 Bacteria 3878
33 AustNasuHG_c1002304 3300000089 Bacteria 6890
34 JGI24698J34947_10035237 3300002449 Bacteria 2614
35 Ga0466719_037607 3300042606 Bacteria 3509
36 Ga0466719_132470 3300042606 Bacteria 7097
37 Ga0466722_143507 3300042609 Bacteria 5934
38 Ga0466690_024237 3300042590 Bacteria 4437
39 Ga0466692_024063 3300042591 Bacteria 5272
40 Ga0466723_007298 3300042618 Bacteria 4803
41 Ga0466723_041142 3300042618 Bacteria 41550
42 Ga0466703_320231 3300042636 Bacteria 76119
43 Ga0466719_099189 3300042606 Bacteria 7858
44 Ga0466719_387130 3300042606 Bacteria 6281
45 Ga0415639_225505 3300038395 Bacteria 2992
46 Ga0466692_009382 3300042591 Bacteria 6606
47 Ga0466691_125507 3300042593 Bacteria 45141
48 Ga0466691_160224 3300042593 Bacteria 27887
49 Ga0466691_214229 3300042593 Bacteria 2780
50 Ga0466691_225239 3300042593 Bacteria 6716
51 Ga0466723_053405 3300042618 Bacteria 7933
52 Ga0466723_296024 3300042618 Bacteria 6069
53 Ga0466726_135089 3300042619 Bacteria 2851
54 Ga0466726_148630 3300042619 Bacteria 3605
55 Ga0466726_156777 3300042619 Bacteria 5708
56 Ga0466703_017200 3300042636 Bacteria 10151
57 Ga0466704_035916 3300042643 Bacteria 4138
58 Ga0466704_367809 3300042643 Bacteria 3049
59 Ga0466709_120000 3300042648 Bacteria 2220
60 Ga0466708_395222 3300042652 Bacteria 2466
61 Ga0466716_205158 3300042605 Bacteria 2771
62 Ga0466719_115018 3300042606 Bacteria 2620
63 Ga0466722_183459 3300042609 Bacteria 12396
64 Ga0456237_0000963 3300041968 Bacteria 4537
65 Ga0466690_132450 3300042590 Bacteria 10949
66 Ga0466696_237330 3300042596 Bacteria 7902
67 Ga0466705_067560 3300042612 Bacteria 36632
68 Ga0466705_248949 3300042612 Bacteria 2587
69 Ga0466712_030357 3300042614 Bacteria 33145
70 Ga0466711_069215 3300042615 Bacteria 18178
71 Ga0466723_328229 3300042618 Bacteria 2904
72 Ga0466728_016005 3300042620 Bacteria 7236
73 Ga0466704_067072 3300042643 Bacteria 8053
74 Ga0466704_108328 3300042643 Bacteria 14496
75 Ga0466704_140178 3300042643 Bacteria 60046
76 Ga0466704_187511 3300042643 Bacteria 8398
77 Ga0466704_209964 3300042643 Bacteria 21692
78 Ga0466704_277071 3300042643 Bacteria 3660
79 Ga0466709_046619 3300042648 Bacteria 1769
80 Ga0466709_307364 3300042648 Bacteria 2520
81 Ga0466708_153665 3300042652 Bacteria 9204
82 JGI24698J34947_10022769 3300002449 Bacteria 3356
83 JGI24702J35022_10008784 3300002462 Bacteria 5706
84 Ga0072941_1043197 3300005201 Bacteria 4214
85 Ga0072941_1047463 3300005201 Bacteria 8434
86 Ga0466722_085271 3300042609 Bacteria 6796
87 Ga0466690_164894 3300042590 Bacteria 1550
88 Ga0466690_354853 3300042590 Bacteria 3053
89 Ga0466692_050544 3300042591 Bacteria 5962
90 Ga0466696_257067 3300042596 Bacteria 31188
91 Ga0466712_226137 3300042614 Bacteria 2042
92 Ga0466715_018752 3300042616 Bacteria 8324
93 Ga0466715_379733 3300042616 Bacteria 2068
94 Ga0466709_024787 3300042648 Bacteria 26369
95 Ga0466727_291739 3300042655 Bacteria 4075
96 JGI24695J34938_10003708 3300002450 Bacteria 10441
97 JGI24695J34938_10027197 3300002450 Archaea 2707
98 Ga0466716_401258 3300042605 Bacteria 7367
99 Ga0466722_035581 3300042609 Bacteria 3428
100 Ga0466715_177662 3300042616 Bacteria 9017
101 Ga0466718_051412 3300042617 Bacteria 10135
102 Ga0466723_030196 3300042618 Bacteria 35787
103 Ga0466723_185749 3300042618 Bacteria 2469
104 Ga0466723_269642 3300042618 Bacteria 2725
105 Ga0466726_385935 3300042619 Bacteria 3349
106 Ga0466728_091105 3300042620 Bacteria 3877
107 Ga0466703_050330 3300042636 Bacteria 11216
108 Ga0466704_120876 3300042643 Bacteria 38816
109 Ga0466691_080576 3300042593 Bacteria 2782
110 Ga0466694_150403 3300042594 Bacteria 6263

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_041142 Ga0466723_041142_322_1692 398
2 3300042610 Ga0466698_410570 Ga0466698_410570_1035_2255 406
3 3300042590 Ga0466690_164894 Ga0466690_164894_241_1485 414
4 3300042620 Ga0466728_016005 Ga0466728_016005_3856_5226 421
5 3300042618 Ga0466723_030196 Ga0466723_030196_27667_29007 426
6 3300042648 Ga0466709_383559 Ga0466709_383559_1124_2494 427
7 3300042590 Ga0466690_132450 Ga0466690_132450_4760_6100 429
8 3300042643 Ga0466704_236061 Ga0466704_236061_4358_5698 431
9 3300042648 Ga0466709_046619 Ga0466709_046619_461_1756 431
10 3300041968 Ga0456237_0008062 Ga0456237_0008062_210_1550 437
11 3300042617 Ga0466718_051412 Ga0466718_051412_3919_5361 439
12 3300042593 Ga0466691_160224 Ga0466691_160224_11737_13077 440
13 3300042606 Ga0466719_132470 Ga0466719_132470_1877_3202 441
14 3300042590 Ga0466690_020146 Ga0466690_020146_3354_4694 446
15 3300042591 Ga0466692_137360 Ga0466692_137360_8442_9782 446
16 3300042593 Ga0466691_214229 Ga0466691_214229_447_1787 446
17 3300042605 Ga0466716_205158 Ga0466716_205158_579_1919 446
18 3300042606 Ga0466719_115018 Ga0466719_115018_1232_2572 446
19 3300042609 Ga0466722_183459 Ga0466722_183459_7265_8605 446
20 3300042612 Ga0466705_067560 Ga0466705_067560_34071_35411 446
21 3300042612 Ga0466705_248949 Ga0466705_248949_653_1993 446
22 3300042612 Ga0466705_266113 Ga0466705_266113_31005_32345 446
23 3300042618 Ga0466723_007298 Ga0466723_007298_2776_4116 446
24 3300042618 Ga0466723_269642 Ga0466723_269642_102_1442 446
25 3300042643 Ga0466704_140178 Ga0466704_140178_25874_27214 446
26 3300042648 Ga0466709_307364 Ga0466709_307364_726_2066 446
27 3300042643 Ga0466704_277071 Ga0466704_277071_1129_2571 447
28 3300042591 Ga0466692_029512 Ga0466692_029512_254_1675 448
29 3300042605 Ga0466716_401258 Ga0466716_401258_1598_2971 449
30 3300042591 Ga0466692_050544 Ga0466692_050544_1073_2440 455
31 3300042619 Ga0466726_135089 Ga0466726_135089_960_2327 455
32 3300042594 Ga0466694_150403 Ga0466694_150403_3455_4909 456
33 3300042620 Ga0466728_091105 Ga0466728_091105_1956_3398 457
34 3300042655 Ga0466727_291739 Ga0466727_291739_883_2325 457
35 3300042636 Ga0466703_236604 Ga0466703_236604_2171_3613 458
36 3300042612 Ga0466705_055972 Ga0466705_055972_4249_5691 459
37 3300042616 Ga0466715_018752 Ga0466715_018752_4252_5631 459
38 3300042643 Ga0466704_067072 Ga0466704_067072_2866_4308 459
39 3300042652 Ga0466708_153665 Ga0466708_153665_4886_6328 460
40 3300042648 Ga0466709_120000 Ga0466709_120000_101_1543 461
41 3300042596 Ga0466696_257067 Ga0466696_257067_14570_16015 462
42 3300042606 Ga0466719_099189 Ga0466719_099189_2272_3714 462
43 3300005201 Ga0072941_1043197 Ga0072941_10431974 463
44 3300042618 Ga0466723_328229 Ga0466723_328229_710_2152 463
45 3300042652 Ga0466708_141296 Ga0466708_141296_1001_2443 463
46 3300038395 Ga0415639_225505 Ga0415639_225505_625_2079 464
47 3300042593 Ga0466691_214205 Ga0466691_214205_2419_3861 465
48 3300042590 Ga0466690_024237 Ga0466690_024237_2456_3898 466
49 3300042606 Ga0466719_387130 Ga0466719_387130_1060_2508 466
50 3300042615 Ga0466711_069215 Ga0466711_069215_15581_17023 466
51 3300042648 Ga0466709_024787 Ga0466709_024787_3470_4912 466
52 3300042652 Ga0466708_102129 Ga0466708_102129_363_1805 466
53 3300042655 Ga0466727_204838 Ga0466727_204838_1500_2942 466
54 3300002450 JGI24695J34938_10004053 JGI24695J34938_1000405311 467
55 3300041968 Ga0456237_0000963 Ga0456237_0000963_2213_3655 467
56 3300042616 Ga0466715_289814 Ga0466715_289814_307_1752 467
57 3300000089 AustNasuHG_c1002304 AustNasuHG_10023042 468
58 3300042652 Ga0466708_395222 Ga0466708_395222_305_1714 469
59 3300002449 JGI24698J34947_10035237 JGI24698J34947_100352372 470
60 3300002450 JGI24695J34938_10003708 JGI24695J34938_100037082 471
61 3300042594 Ga0466694_342275 Ga0466694_342275_13526_14986 472
62 3300042591 Ga0466692_009382 Ga0466692_009382_2167_3588 473
63 3300002449 JGI24698J34947_10022769 JGI24698J34947_100227692 479
64 3300042590 Ga0466690_354853 Ga0466690_354853_1397_2839 480
65 3300042591 Ga0466692_111092 Ga0466692_111092_1893_3335 480
66 3300042591 Ga0466692_169671 Ga0466692_169671_54_1496 480
67 3300042593 Ga0466691_080576 Ga0466691_080576_831_2273 480
68 3300042596 Ga0466696_237330 Ga0466696_237330_2019_3461 480
69 3300042606 Ga0466719_037607 Ga0466719_037607_1666_3108 480
70 3300042609 Ga0466722_085271 Ga0466722_085271_4393_5835 480
71 3300042609 Ga0466722_143507 Ga0466722_143507_1188_2630 480
72 3300042612 Ga0466705_207657 Ga0466705_207657_182_1624 480
73 3300042612 Ga0466705_246027 Ga0466705_246027_20558_22000 480
74 3300042614 Ga0466712_226137 Ga0466712_226137_218_1660 480
75 3300042616 Ga0466715_177662 Ga0466715_177662_1380_2822 480
76 3300042616 Ga0466715_379733 Ga0466715_379733_215_1657 480
77 3300042618 Ga0466723_053405 Ga0466723_053405_5051_6493 480
78 3300042618 Ga0466723_054937 Ga0466723_054937_7319_8761 480
79 3300042618 Ga0466723_185749 Ga0466723_185749_656_2098 480
80 3300042618 Ga0466723_296024 Ga0466723_296024_3917_5359 480
81 3300042619 Ga0466726_148630 Ga0466726_148630_1885_3327 480
82 3300042619 Ga0466726_156777 Ga0466726_156777_2899_4341 480
83 3300042620 Ga0466728_155905 Ga0466728_155905_1227_2669 480
84 3300042620 Ga0466728_444536 Ga0466728_444536_9508_10950 480
85 3300042636 Ga0466703_050330 Ga0466703_050330_1101_2543 480
86 3300042636 Ga0466703_082492 Ga0466703_082492_1673_3115 480
87 3300042636 Ga0466703_232830 Ga0466703_232830_6520_7962 480
88 3300042636 Ga0466703_255550 Ga0466703_255550_8430_9872 480
89 3300042636 Ga0466703_320231 Ga0466703_320231_12524_13966 480
90 3300042643 Ga0466704_035916 Ga0466704_035916_1500_2942 480
91 3300042643 Ga0466704_108328 Ga0466704_108328_12275_13717 480
92 3300042643 Ga0466704_120876 Ga0466704_120876_33692_35134 480
93 3300042643 Ga0466704_209964 Ga0466704_209964_978_2420 480
94 3300042643 Ga0466704_367809 Ga0466704_367809_818_2260 480
95 3300042648 Ga0466709_000526 Ga0466709_000526_4199_5641 480
96 3300042655 Ga0466727_068955 Ga0466727_068955_681_2123 480
97 3300042655 Ga0466727_310093 Ga0466727_310093_250_1692 480
98 iso_pr_bacteria 2781125695 2781438658 480
99 3300002462 JGI24702J35022_10008784 JGI24702J35022_100087842 481
100 3300005201 Ga0072941_1047463 Ga0072941_10474635 481
101 3300042609 Ga0466722_035581 Ga0466722_035581_876_2321 481
102 3300042614 Ga0466712_030357 Ga0466712_030357_27261_28730 481
103 3300042636 Ga0466703_017200 Ga0466703_017200_2628_4073 481
104 3300042643 Ga0466704_187511 Ga0466704_187511_6496_7944 482
105 3300042591 Ga0466692_024063 Ga0466692_024063_3565_5019 484
106 3300002450 JGI24695J34938_10027197 JGI24695J34938_100271972 488
107 3300002450 JGI24695J34938_10058095 JGI24695J34938_100580951 488
108 iso_pr_bacteria 2781125633 2781273022 490
109 3300042593 Ga0466691_225239 Ga0466691_225239_3829_5340 503
110 3300042619 Ga0466726_385935 Ga0466726_385935_663_2177 504
111 3300042636 Ga0466703_011948 Ga0466703_011948_7813_9330 505
112 3300042593 Ga0466691_125507 Ga0466691_125507_26289_27896 509

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02397 Bac_transf Bacterial sugar transferase 312 504 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.