Protein Family IF04905
Metagenome
Isolate
124
Members
56
Samples
120
Scaffolds
371
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_112664|Ga0466691_112664_1344_2555
- Length
- 403 aa
- Sequence
- MGKDVLKVKREEFNSVTGMTKNDIQGNDTEQAIKGLRSLSLFSGAGGMDIGVKKAGFEILAEIEVDQYCCQTLRAACEREKRNTFVIENDIHQIDPQILMKELNIKSRELDLLFGGPPCQPFSLAGKQNSLNDIRGPLLFEIIRFSEAFKPKVIFLEQVKGLLSAKGKDGKKGGVFQTFLSELERLQYTPKWQVCRAADYGVPQLRERVLVVATYGKNGFKFPEQTHVPKEVANNLFNLKPYVTVGEALAGLGKPAPKTPGTTFFNVSDSHVDVTPPRDRERIANVPEGFYLASQTQLDKSILCNLSPKDTTKYLRLHRERPSNTLRCGEIFYHPTENRYLTPREYMRLHGYDDDYLLLGPIRSRTGTVKNLDQHRQVANSVPPPLAYAVAKQIKDFLNEQDL
Sample Types
Isolate
3.2%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Kalotermitidae
24.1%
Unclassified
13.0%
Rhinotermitidae
7.4%
Termopsidae
7.4%
Passalidae
1.9%
Hodotermitidae
1.9%
Taxonomy
Archaea
2
Bacteria
110
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 13 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 14 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 23 | 2773857696 | Unclassified Methanomassiliicoccaceae Th196P4bin4 | Isolate | Unclassified |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 28 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 42 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_154212 | 3300042611 | Bacteria | 2645 |
| 2 | Ga0466731_242290 | 3300042622 | Bacteria | 1901 |
| 3 | Ga0466702_037043 | 3300042635 | Bacteria | 3628 |
| 4 | Ga0123356_10031737 | 3300010049 | Unclassified | 4944 |
| 5 | Ga0123356_10043208 | 3300010049 | Bacteria | 4196 |
| 6 | Ga0123353_10076193 | 3300010167 | Bacteria | 5390 |
| 7 | Ga0466712_173291 | 3300042614 | Bacteria | 9044 |
| 8 | Ga0466718_119356 | 3300042617 | Bacteria | 41583 |
| 9 | Ga0466729_127926 | 3300042621 | Bacteria | 2581 |
| 10 | Ga0466690_146198 | 3300042590 | Bacteria | 4713 |
| 11 | Ga0466691_020196 | 3300042593 | Bacteria | 8134 |
| 12 | Ga0466694_379468 | 3300042594 | Bacteria | 4460 |
| 13 | Ga0072940_1207015 | 3300005200 | Bacteria | 2705 |
| 14 | Ga0072941_1404767 | 3300005201 | Bacteria | 2067 |
| 15 | Ga0123356_10130356 | 3300010049 | Bacteria | 2462 |
| 16 | Ga0123353_10044768 | 3300010167 | Bacteria | 7018 |
| 17 | Ga0123353_10353978 | 3300010167 | Bacteria | 2211 |
| 18 | Ga0466712_217234 | 3300042614 | Bacteria | 10898 |
| 19 | Ga0466723_100799 | 3300042618 | Bacteria | 4096 |
| 20 | Ga0466728_375569 | 3300042620 | Bacteria | 1330 |
| 21 | Ga0466706_122684 | 3300042599 | Bacteria | 2674 |
| 22 | Ga0466698_079843 | 3300042610 | Bacteria | 2360 |
| 23 | Ga0466691_097046 | 3300042593 | Bacteria | 23291 |
| 24 | AustNasuHG_c1003665 | 3300000089 | Bacteria | 5536 |
| 25 | JGI24698J34947_10054333 | 3300002449 | Bacteria | 2000 |
| 26 | Ga0466734_103593 | 3300042623 | Bacteria | 2005 |
| 27 | Ga0466735_023753 | 3300042624 | Bacteria | 3153 |
| 28 | Ga0466708_074914 | 3300042652 | Bacteria | 7523 |
| 29 | Ga0123356_10118590 | 3300010049 | Bacteria | 2570 |
| 30 | Ga0123353_10081943 | 3300010167 | Bacteria | 5189 |
| 31 | Ga0466712_122789 | 3300042614 | Bacteria | 1677 |
| 32 | Ga0466711_169221 | 3300042615 | Bacteria | 3239 |
| 33 | Ga0466715_595713 | 3300042616 | Bacteria | 4980 |
| 34 | Ga0466715_611263 | 3300042616 | Bacteria | 4256 |
| 35 | Ga0466718_162963 | 3300042617 | Bacteria | 4362 |
| 36 | Ga0466706_034816 | 3300042599 | Bacteria | 21846 |
| 37 | Ga0466707_151704 | 3300042601 | Bacteria | 1380 |
| 38 | Ga0466717_075191 | 3300042604 | Bacteria | 1561 |
| 39 | Ga0466719_052417 | 3300042606 | Bacteria | 3232 |
| 40 | Ga0466691_112664 | 3300042593 | Bacteria | 14114 |
| 41 | Ga0466694_189106 | 3300042594 | Bacteria | 5309 |
| 42 | AustNasuHG_c1007107 | 3300000089 | Bacteria | 3988 |
| 43 | Ga0068302_10234559 | 3300005071 | Unclassified | 3399 |
| 44 | Ga0072940_1113316 | 3300005200 | Unclassified | 1505 |
| 45 | Ga0466704_220251 | 3300042643 | Bacteria | 4699 |
| 46 | Ga0466709_339368 | 3300042648 | Bacteria | 2217 |
| 47 | Ga0466725_033741 | 3300042654 | Bacteria | 1923 |
| 48 | Ga0466727_001710 | 3300042655 | Bacteria | 3177 |
| 49 | Ga0466727_007480 | 3300042655 | Bacteria | 5818 |
| 50 | Ga0123353_10297761 | 3300010167 | Bacteria | 2465 |
| 51 | Ga0466718_062277 | 3300042617 | Bacteria | 6887 |
| 52 | Ga0466718_084411 | 3300042617 | Bacteria | 10289 |
| 53 | Ga0466723_215234 | 3300042618 | Bacteria | 1660 |
| 54 | Ga0466706_027781 | 3300042599 | Bacteria | 2891 |
| 55 | Ga0466706_151439 | 3300042599 | Bacteria | 27441 |
| 56 | Ga0466716_280364 | 3300042605 | Bacteria | 1659 |
| 57 | Ga0466722_175949 | 3300042609 | Bacteria | 4287 |
| 58 | Ga0264413_131319 | 3300024493 | Bacteria | 2264 |
| 59 | Ga0466696_117922 | 3300042596 | Bacteria | 2677 |
| 60 | Ga0466696_132106 | 3300042596 | Bacteria | 4204 |
| 61 | JGI24702J35022_10000080 | 3300002462 | Bacteria | 42310 |
| 62 | Ga0068305_10286267 | 3300005083 | Bacteria | 4327 |
| 63 | Ga0466705_067871 | 3300042612 | Bacteria | 96475 |
| 64 | Ga0466702_233230 | 3300042635 | Bacteria | 3792 |
| 65 | Ga0466708_048301 | 3300042652 | Bacteria | 9068 |
| 66 | Ga0123355_10086387 | 3300009826 | Unclassified | 4989 |
| 67 | Ga0123356_10023744 | 3300010049 | Bacteria | 5769 |
| 68 | Ga0123353_10095323 | 3300010167 | Bacteria | 4795 |
| 69 | Ga0466728_293444 | 3300042620 | Bacteria | 3070 |
| 70 | Ga0466706_032968 | 3300042599 | Unclassified | 4451 |
| 71 | Ga0466719_529299 | 3300042606 | Bacteria | 2991 |
| 72 | Ga0466690_178038 | 3300042590 | Bacteria | 2221 |
| 73 | Ga0466692_161719 | 3300042591 | Bacteria | 15025 |
| 74 | 2227233576 | 2225789004 | Archaea | 7329 |
| 75 | AustNasuHG_c1019880 | 3300000089 | Bacteria | 2196 |
| 76 | JGI24695J34938_10058848 | 3300002450 | Unclassified | 1646 |
| 77 | Ga0466735_225908 | 3300042624 | Bacteria | 1630 |
| 78 | Ga0466702_000963 | 3300042635 | Bacteria | 3807 |
| 79 | Ga0466702_249098 | 3300042635 | Bacteria | 2853 |
| 80 | Ga0466704_158465 | 3300042643 | Bacteria | 2820 |
| 81 | Ga0123356_10117998 | 3300010049 | Bacteria | 2575 |
| 82 | Ga0123353_10326591 | 3300010167 | Bacteria | 2325 |
| 83 | Ga0466701_051340 | 3300042598 | Unclassified | 10362 |
| 84 | Ga0466700_470973 | 3300042600 | Unclassified | 6297 |
| 85 | Ga0466713_084873 | 3300042602 | Bacteria | 2679 |
| 86 | Ga0456237_0002185 | 3300041968 | Bacteria | 3162 |
| 87 | Ga0466692_147690 | 3300042591 | Bacteria | 2752 |
| 88 | Ga0466695_203765 | 3300042595 | Bacteria | 3181 |
| 89 | Ga0466699_084080 | 3300042597 | Bacteria | 4709 |
| 90 | Ga0466699_188964 | 3300042597 | Bacteria | 3644 |
| 91 | JGI24698J34947_10005858 | 3300002449 | Unclassified | 6734 |
| 92 | JGI24698J34947_10032301 | 3300002449 | Unclassified | 2750 |
| 93 | Ga0072941_1283471 | 3300005201 | Bacteria | 2104 |
| 94 | Ga0466704_016352 | 3300042643 | Bacteria | 60527 |
| 95 | Ga0466704_294466 | 3300042643 | Unclassified | 4689 |
| 96 | Ga0466708_024360 | 3300042652 | Bacteria | 62819 |
| 97 | Ga0466708_039186 | 3300042652 | Bacteria | 2805 |
| 98 | Ga0123353_10254708 | 3300010167 | Bacteria | 2715 |
| 99 | Ga0466712_083241 | 3300042614 | Bacteria | 10450 |
| 100 | Ga0466711_235741 | 3300042615 | Bacteria | 76629 |
| 101 | Ga0466718_001314 | 3300042617 | Bacteria | 1338 |
| 102 | Ga0466726_301547 | 3300042619 | Bacteria | 2542 |
| 103 | Ga0466728_068720 | 3300042620 | Bacteria | 6260 |
| 104 | Ga0415639_061753 | 3300038395 | Bacteria | 2921 |
| 105 | Ga0466690_050277 | 3300042590 | Bacteria | 2843 |
| 106 | Ga0466694_275918 | 3300042594 | Bacteria | 2008 |
| 107 | AustNasuHG_c1013892 | 3300000089 | Bacteria | 2751 |
| 108 | Ga0072941_1044211 | 3300005201 | Bacteria | 40332 |
| 109 | Ga0466705_079437 | 3300042612 | Bacteria | 9677 |
| 110 | Ga0466733_136800 | 3300042659 | Bacteria | 5226 |
| 111 | Ga0466704_351865 | 3300042643 | Bacteria | 3099 |
| 112 | Ga0466708_060766 | 3300042652 | Bacteria | 29100 |
| 113 | Ga0466727_042195 | 3300042655 | Bacteria | 3669 |
| 114 | Ga0466715_055965 | 3300042616 | Bacteria | 8340 |
| 115 | Ga0466718_026962 | 3300042617 | Bacteria | 6300 |
| 116 | Ga0466723_030930 | 3300042618 | Bacteria | 5807 |
| 117 | Ga0466706_085796 | 3300042599 | Bacteria | 24356 |
| 118 | Ga0466719_472545 | 3300042606 | Bacteria | 7221 |
| 119 | Ga0456237_0006292 | 3300041968 | Bacteria | 1868 |
| 120 | Ga0466691_209179 | 3300042593 | Unclassified | 15357 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042612 | Ga0466705_079437 | Ga0466705_079437_78_1007 | 309 |
| 2 | 3300042655 | Ga0466727_007480 | Ga0466727_007480_38_1024 | 328 |
| 3 | 3300042594 | Ga0466694_275918 | Ga0466694_275918_344_1402 | 352 |
| 4 | 3300042616 | Ga0466715_611263 | Ga0466715_611263_939_1997 | 352 |
| 5 | 3300005201 | Ga0072941_1283471 | Ga0072941_12834711 | 353 |
| 6 | 3300005201 | Ga0072941_1404767 | Ga0072941_14047672 | 353 |
| 7 | 3300010049 | Ga0123356_10118590 | Ga0123356_101185902 | 353 |
| 8 | 3300042598 | Ga0466701_051340 | Ga0466701_051340_6992_8053 | 353 |
| 9 | 3300000089 | AustNasuHG_c1019880 | AustNasuHG_10198802 | 354 |
| 10 | 3300010167 | Ga0123353_10326591 | Ga0123353_103265912 | 354 |
| 11 | 3300042599 | Ga0466706_122684 | Ga0466706_122684_385_1449 | 354 |
| 12 | 3300042611 | Ga0466697_154212 | Ga0466697_154212_1374_2438 | 354 |
| 13 | 3300010049 | Ga0123356_10043208 | Ga0123356_100432083 | 356 |
| 14 | 3300042595 | Ga0466695_203765 | Ga0466695_203765_186_1256 | 356 |
| 15 | 3300042614 | Ga0466712_173291 | Ga0466712_173291_4041_5111 | 356 |
| 16 | 3300042617 | Ga0466718_062277 | Ga0466718_062277_4457_5563 | 356 |
| 17 | 3300042643 | Ga0466704_294466 | Ga0466704_294466_3586_4656 | 356 |
| 18 | 3300042617 | Ga0466718_001314 | Ga0466718_001314_121_1194 | 357 |
| 19 | 3300042623 | Ga0466734_103593 | Ga0466734_103593_128_1243 | 357 |
| 20 | 3300005071 | Ga0068302_10234559 | Ga0068302_102345593 | 358 |
| 21 | 3300010049 | Ga0123356_10130356 | Ga0123356_101303564 | 358 |
| 22 | 3300042617 | Ga0466718_119356 | Ga0466718_119356_15259_16365 | 359 |
| 23 | 3300005200 | Ga0072940_1207015 | Ga0072940_12070152 | 360 |
| 24 | 3300000089 | AustNasuHG_c1007107 | AustNasuHG_10071072 | 362 |
| 25 | 3300042601 | Ga0466707_151704 | Ga0466707_151704_108_1196 | 362 |
| 26 | 3300042606 | Ga0466719_472545 | Ga0466719_472545_699_1859 | 365 |
| 27 | 3300042652 | Ga0466708_060766 | Ga0466708_060766_19791_20888 | 365 |
| 28 | 3300042652 | Ga0466708_024360 | Ga0466708_024360_61186_62286 | 366 |
| 29 | 3300024493 | Ga0264413_131319 | Ga0264413_1313192 | 368 |
| 30 | 3300042590 | Ga0466690_178038 | Ga0466690_178038_650_1756 | 368 |
| 31 | 3300042593 | Ga0466691_020196 | Ga0466691_020196_5010_6116 | 368 |
| 32 | 3300042593 | Ga0466691_209179 | Ga0466691_209179_12878_13984 | 368 |
| 33 | 3300042597 | Ga0466699_084080 | Ga0466699_084080_1498_2604 | 368 |
| 34 | 3300042600 | Ga0466700_470973 | Ga0466700_470973_1976_3082 | 368 |
| 35 | 3300042604 | Ga0466717_075191 | Ga0466717_075191_434_1540 | 368 |
| 36 | 3300042606 | Ga0466719_052417 | Ga0466719_052417_1339_2445 | 368 |
| 37 | 3300042610 | Ga0466698_079843 | Ga0466698_079843_1014_2120 | 368 |
| 38 | 3300042615 | Ga0466711_169221 | Ga0466711_169221_675_1781 | 368 |
| 39 | 3300042635 | Ga0466702_249098 | Ga0466702_249098_486_1592 | 368 |
| 40 | 3300000089 | AustNasuHG_c1003665 | AustNasuHG_10036654 | 369 |
| 41 | 3300000089 | AustNasuHG_c1013892 | AustNasuHG_10138922 | 369 |
| 42 | 3300002449 | JGI24698J34947_10032301 | JGI24698J34947_100323012 | 369 |
| 43 | 3300002449 | JGI24698J34947_10054333 | JGI24698J34947_100543332 | 369 |
| 44 | 3300002450 | JGI24695J34938_10058848 | JGI24695J34938_100588482 | 369 |
| 45 | 3300005083 | Ga0068305_10286267 | Ga0068305_102862673 | 369 |
| 46 | 3300005200 | Ga0072940_1113316 | Ga0072940_11133162 | 369 |
| 47 | 3300010049 | Ga0123356_10117998 | Ga0123356_101179981 | 369 |
| 48 | 3300010167 | Ga0123353_10095323 | Ga0123353_100953232 | 369 |
| 49 | 3300041968 | Ga0456237_0006292 | Ga0456237_0006292_56_1165 | 369 |
| 50 | 3300042605 | Ga0466716_280364 | Ga0466716_280364_354_1463 | 369 |
| 51 | 3300042619 | Ga0466726_301547 | Ga0466726_301547_706_1815 | 369 |
| 52 | iso_pr_bacteria | 2820344559 | 2820346873 | 369 |
| 53 | 3300042618 | Ga0466723_215234 | Ga0466723_215234_394_1506 | 370 |
| 54 | 3300042591 | Ga0466692_147690 | Ga0466692_147690_389_1504 | 371 |
| 55 | 3300042594 | Ga0466694_189106 | Ga0466694_189106_3104_4219 | 371 |
| 56 | 3300042606 | Ga0466719_529299 | Ga0466719_529299_527_1642 | 371 |
| 57 | 3300042609 | Ga0466722_175949 | Ga0466722_175949_1785_2900 | 371 |
| 58 | 3300042616 | Ga0466715_055965 | Ga0466715_055965_5202_6317 | 371 |
| 59 | 3300042617 | Ga0466718_084411 | Ga0466718_084411_2146_3261 | 371 |
| 60 | 3300042621 | Ga0466729_127926 | Ga0466729_127926_587_1702 | 371 |
| 61 | 3300042622 | Ga0466731_242290 | Ga0466731_242290_315_1430 | 371 |
| 62 | 3300042635 | Ga0466702_037043 | Ga0466702_037043_1865_2980 | 371 |
| 63 | 3300042635 | Ga0466702_233230 | Ga0466702_233230_2555_3670 | 371 |
| 64 | 3300042659 | Ga0466733_136800 | Ga0466733_136800_3612_4727 | 371 |
| 65 | iso_pr_bacteria | 2820072841 | 2820073066 | 371 |
| 66 | 3300002462 | JGI24702J35022_10000080 | JGI24702J35022_1000008014 | 372 |
| 67 | 3300005201 | Ga0072941_1044211 | Ga0072941_104421134 | 372 |
| 68 | 3300009826 | Ga0123355_10086387 | Ga0123355_100863872 | 372 |
| 69 | 3300010049 | Ga0123356_10031737 | Ga0123356_100317375 | 372 |
| 70 | 3300010167 | Ga0123353_10353978 | Ga0123353_103539782 | 372 |
| 71 | 3300042591 | Ga0466692_161719 | Ga0466692_161719_10584_11702 | 372 |
| 72 | 3300042597 | Ga0466699_188964 | Ga0466699_188964_1154_2272 | 372 |
| 73 | 3300042612 | Ga0466705_067871 | Ga0466705_067871_40464_41582 | 372 |
| 74 | 3300042620 | Ga0466728_293444 | Ga0466728_293444_1351_2469 | 372 |
| 75 | 3300042635 | Ga0466702_000963 | Ga0466702_000963_1327_2445 | 372 |
| 76 | 2225789004 | 2227233576 | 2227670572 | 373 |
| 77 | 3300010167 | Ga0123353_10297761 | Ga0123353_102977611 | 373 |
| 78 | 3300042599 | Ga0466706_151439 | Ga0466706_151439_2048_3169 | 373 |
| 79 | 3300042602 | Ga0466713_084873 | Ga0466713_084873_616_1737 | 373 |
| 80 | 3300042617 | Ga0466718_162963 | Ga0466718_162963_564_1685 | 373 |
| 81 | 3300042620 | Ga0466728_068720 | Ga0466728_068720_4048_5169 | 373 |
| 82 | 3300042624 | Ga0466735_023753 | Ga0466735_023753_1018_2139 | 373 |
| 83 | 3300042643 | Ga0466704_158465 | Ga0466704_158465_1234_2355 | 373 |
| 84 | 3300042654 | Ga0466725_033741 | Ga0466725_033741_243_1364 | 373 |
| 85 | 3300010049 | Ga0123356_10023744 | Ga0123356_100237444 | 374 |
| 86 | 3300010167 | Ga0123353_10044768 | Ga0123353_100447683 | 374 |
| 87 | 3300042593 | Ga0466691_097046 | Ga0466691_097046_5079_6203 | 374 |
| 88 | iso_pr_bacteria | 2820246658 | 2820247631 | 374 |
| 89 | 3300042624 | Ga0466735_225908 | Ga0466735_225908_116_1243 | 375 |
| 90 | 3300010167 | Ga0123353_10076193 | Ga0123353_100761934 | 376 |
| 91 | 3300042599 | Ga0466706_034816 | Ga0466706_034816_13884_15014 | 376 |
| 92 | 3300042616 | Ga0466715_595713 | Ga0466715_595713_1692_2822 | 376 |
| 93 | 3300042620 | Ga0466728_375569 | Ga0466728_375569_44_1174 | 376 |
| 94 | 3300010167 | Ga0123353_10081943 | Ga0123353_100819435 | 377 |
| 95 | 3300042599 | Ga0466706_027781 | Ga0466706_027781_471_1604 | 377 |
| 96 | 3300042617 | Ga0466718_026962 | Ga0466718_026962_456_1589 | 377 |
| 97 | 3300010167 | Ga0123353_10254708 | Ga0123353_102547083 | 379 |
| 98 | 3300042599 | Ga0466706_032968 | Ga0466706_032968_3195_4334 | 379 |
| 99 | 3300042590 | Ga0466690_146198 | Ga0466690_146198_2660_3802 | 380 |
| 100 | 3300041968 | Ga0456237_0002185 | Ga0456237_0002185_1959_3107 | 382 |
| 101 | 3300042615 | Ga0466711_235741 | Ga0466711_235741_45044_46192 | 382 |
| 102 | 3300042648 | Ga0466709_339368 | Ga0466709_339368_507_1655 | 382 |
| 103 | iso_pu_archaea | 2773857696 | 2774172712 | 383 |
| 104 | 3300042618 | Ga0466723_100799 | Ga0466723_100799_834_1988 | 384 |
| 105 | 3300042596 | Ga0466696_132106 | Ga0466696_132106_1818_2975 | 385 |
| 106 | 3300042599 | Ga0466706_085796 | Ga0466706_085796_535_1692 | 385 |
| 107 | 3300042618 | Ga0466723_030930 | Ga0466723_030930_3202_4359 | 385 |
| 108 | 3300042643 | Ga0466704_016352 | Ga0466704_016352_45973_47130 | 385 |
| 109 | 3300042643 | Ga0466704_220251 | Ga0466704_220251_1777_2934 | 385 |
| 110 | 3300042643 | Ga0466704_351865 | Ga0466704_351865_506_1663 | 385 |
| 111 | 3300042652 | Ga0466708_048301 | Ga0466708_048301_1509_2666 | 385 |
| 112 | 3300042652 | Ga0466708_074914 | Ga0466708_074914_2794_3951 | 385 |
| 113 | 3300042655 | Ga0466727_042195 | Ga0466727_042195_2305_3462 | 385 |
| 114 | 3300002449 | JGI24698J34947_10005858 | JGI24698J34947_100058584 | 387 |
| 115 | 3300042614 | Ga0466712_083241 | Ga0466712_083241_990_2153 | 387 |
| 116 | 3300042614 | Ga0466712_122789 | Ga0466712_122789_375_1538 | 387 |
| 117 | 3300042614 | Ga0466712_217234 | Ga0466712_217234_5043_6206 | 387 |
| 118 | 3300042652 | Ga0466708_039186 | Ga0466708_039186_1468_2634 | 388 |
| 119 | 3300042655 | Ga0466727_001710 | Ga0466727_001710_740_1915 | 391 |
| 120 | 3300038395 | Ga0415639_061753 | Ga0415639_061753_1176_2390 | 395 |
| 121 | 3300042590 | Ga0466690_050277 | Ga0466690_050277_1376_2566 | 396 |
| 122 | 3300042596 | Ga0466696_117922 | Ga0466696_117922_589_1788 | 399 |
| 123 | 3300042594 | Ga0466694_379468 | Ga0466694_379468_2001_3203 | 400 |
| 124 | 3300042593 | Ga0466691_112664 | Ga0466691_112664_1344_2555 | 403 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00145 | DNA_methylase | C-5 cytosine-specific DNA methylase | 37 | 395 | 0.78 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00145 | GO:0008168 | methyltransferase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.