Protein Family IF04874

Metagenome Isolate
189 Members
74 Samples
156 Scaffolds
418.92 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_072180|Ga0466691_072180_1486_3021
Length
511 aa
Sequence
MATFAPLATLSPASWPAKGLAFWPEWTVLALWLNYWFLFLAIDCRLSYNHNATGKAANVPAGAVGREIGARRPWEDNPSTEGWAHKIKRSHETVNHDIKDINLASKGNDRIEWAAKSMPVLELIGERFKKEQPLKGLRLGLCLHVTTETASLCRVLKAGGGEVYLCASNPLSTQDEVAAALVKFDGIPVFAVKGEDNPTYYKHIHSVLDAKPHMTMDDGADLLSTLHAEKPELLAGVIGGTEETTTGIIRLRAMAAEKALKYPVVAVNDAMTKHFFDNRYGTGQSTIDGIVRSTNRLLAGSVFVISGYGWCGRGVAKRASGMGARVVVTEVDPLKALEAIMDGFNVMTLAQAAKIGDFFVTVTGDVNVIRPEHFKLMKSGAIVCNSGHFNVELDLEGLAKVTEKRREVRDFVEEYVIKDGPTVYLLGEGRLINLAAAEGHPSSVMDMSFANQALSAEYVKRHQGKLPLEVFAVPEAIDREIARLKLKSMGYEIDTLTEEQVKYLASWKSGT

📊 Sample Types

Isolate 17.5%
Metagenome 82.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 45.9%
Termitidae 21.6%
Kalotermitidae 18.9%
Termopsidae 5.4%
Rhinotermitidae 4.1%
Passalidae 1.4%
Hodotermitidae 1.4%
Formicidae 1.4%

🌳 Taxonomy

Archaea 2
Bacteria 173
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
6 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
7 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
8 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
9 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
10 2820893114 Unclassified Actinobacteria Lab288P1bin125 Isolate Unclassified
11 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
12 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
13 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
14 2820403592 Unclassified Firmicutes Lab288P4bin93 Isolate Unclassified
15 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
29 2820870086 Unclassified Actinobacteria Lab288P3bin107 Isolate Unclassified
30 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
31 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
32 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
33 2791354848 Unclassified Chloroflexi Emb289P3bin155 Isolate Unclassified
34 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
35 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
40 2820940989 Unclassified Actinobacteria Emb289P1bin20 Isolate Unclassified
41 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
42 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
43 2820733257 Unclassified Chloroflexi Lab288P4bin59 Isolate Unclassified
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 2820873081 Unclassified Actinobacteria Lab288P1bin96 Isolate Unclassified
51 2820907832 Unclassified Actinobacteria Emb289P4bin29 Isolate Unclassified
52 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
53 2791354839 Unclassified Chloroflexi Co191P4bin10 Isolate Unclassified
54 2791354849 Unclassified Chloroflexi Lab288P3bin29 Isolate Unclassified
55 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
56 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
57 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
58 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
59 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
60 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
61 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
62 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
63 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
64 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
65 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
66 2820939604 Unclassified Actinobacteria Emb289P1bin4 Isolate Unclassified
67 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
68 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
69 2820731983 Unclassified Chloroflexi Nt197P3bin126 Isolate Unclassified
70 2820734335 Unclassified Chloroflexi Lab288P3bin99 Isolate Unclassified
71 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
74 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_058503 3300042659 Bacteria 5436
2 Ga0466690_193780 3300042590 Bacteria 5941
3 Ga0123357_10031185 3300009784 Bacteria 7233
4 Ga0123356_10034337 3300010049 Bacteria 4740
5 Ga0466705_515927 3300042612 Bacteria 8320
6 Ga0466723_093023 3300042618 Archaea 6707
7 Ga0466723_232786 3300042618 Bacteria 4137
8 Ga0466728_165584 3300042620 Bacteria 25593
9 Ga0466729_005173 3300042621 Bacteria 17241
10 Ga0466719_491287 3300042606 Bacteria 1907
11 Ga0466703_407813 3300042636 Bacteria 118832
12 Ga0466708_204681 3300042652 Bacteria 111842
13 Ga0466705_150221 3300042612 Bacteria 86975
14 Ga0466705_190546 3300042612 Bacteria 10060
15 Ga0466690_023087 3300042590 Bacteria 6452
16 Ga0466691_213478 3300042593 Bacteria 5152
17 Ga0466696_415601 3300042596 Bacteria 9051
18 Ga0123356_10002894 3300010049 Bacteria 18186
19 Ga0123356_10059558 3300010049 Bacteria 3562
20 Ga0123354_10087679 3300010882 Unclassified 4336
21 Ga0466715_331047 3300042616 Bacteria 6593
22 Ga0466723_092498 3300042618 Bacteria 13629
23 Ga0466723_340182 3300042618 Bacteria 3248
24 Ga0466723_367685 3300042618 Bacteria 22939
25 Ga0466728_406814 3300042620 Bacteria 2258
26 JGI24705J35276_12238696 3300002504 Bacteria 38670
27 Ga0068302_10272649 3300005071 Bacteria 2565
28 Ga0466714_032663 3300042603 Bacteria 59155
29 Ga0466716_290801 3300042605 Bacteria 1754
30 Ga0466704_463811 3300042643 Bacteria 3487
31 Ga0466708_008067 3300042652 Bacteria 49835
32 Ga0123353_10001172 3300010167 Bacteria 32006
33 Ga0123354_10017718 3300010882 Bacteria 11161
34 Ga0466711_233252 3300042615 Bacteria 9691
35 Ga0466715_144395 3300042616 Bacteria 42772
36 Ga0466715_445165 3300042616 Bacteria 1841
37 Ga0466723_063624 3300042618 Bacteria 32633
38 Ga0466723_125995 3300042618 Bacteria 41222
39 2227477706 2225789004 Bacteria 4566
40 Ga0466700_389913 3300042600 Bacteria 2167
41 Ga0466713_035394 3300042602 Bacteria 62034
42 Ga0466716_171514 3300042605 Bacteria 9744
43 Ga0466716_181897 3300042605 Bacteria 2812
44 Ga0466719_435978 3300042606 Bacteria 4530
45 Ga0466704_028361 3300042643 Bacteria 18654
46 Ga0466705_178218 3300042612 Bacteria 21616
47 Ga0466696_257149 3300042596 Bacteria 5567
48 Ga0123355_10143128 3300009826 Bacteria 3652
49 Ga0123355_10222487 3300009826 Unclassified 2711
50 Ga0123356_10007223 3300010049 Bacteria 11110
51 Ga0123353_10010945 3300010167 Unclassified 12721
52 Ga0466723_123652 3300042618 Bacteria 16024
53 Ga0466723_180400 3300042618 Bacteria 3672
54 Ga0466726_342534 3300042619 Bacteria 5130
55 Ga0466706_155444 3300042599 Bacteria 3735
56 Ga0466717_235431 3300042604 Bacteria 1848
57 Ga0466735_234538 3300042624 Bacteria 15576
58 Ga0466703_059198 3300042636 Bacteria 12728
59 Ga0466704_159851 3300042643 Bacteria 2888
60 Ga0466704_228191 3300042643 Bacteria 3673
61 Ga0466709_324654 3300042648 Bacteria 3308
62 Ga0466705_269816 3300042612 Bacteria 17674
63 Ga0466691_088455 3300042593 Bacteria 17602
64 Ga0123357_10007296 3300009784 Unclassified 13641
65 Ga0123356_10014194 3300010049 Bacteria 7662
66 Ga0123353_10027784 3300010167 Bacteria 8677
67 Ga0123354_10155410 3300010882 Bacteria 2747
68 Ga0466705_428617 3300042612 Unclassified 12229
69 Ga0466715_271792 3300042616 Bacteria 4831
70 Ga0466715_574337 3300042616 Bacteria 4562
71 Ga0466715_622217 3300042616 Bacteria 2655
72 Ga0466723_119664 3300042618 Bacteria 9088
73 Ga0466726_077587 3300042619 Bacteria 39307
74 Ga0466726_395278 3300042619 Bacteria 1622
75 Ga0466729_186881 3300042621 Bacteria 7306
76 JGI24702J35022_10039862 3300002462 Bacteria 2506
77 Ga0466713_097113 3300042602 Bacteria 48226
78 Ga0466716_361943 3300042605 Bacteria 1556
79 Ga0466722_083333 3300042609 Bacteria 55861
80 Ga0466704_566659 3300042643 Bacteria 2463
81 Ga0466709_180278 3300042648 Bacteria 4190
82 Ga0466727_006635 3300042655 Bacteria 14956
83 Ga0466705_151951 3300042612 Unclassified 15959
84 Ga0466705_327500 3300042612 Bacteria 20390
85 Ga0123355_10000111 3300009826 Bacteria 91183
86 Ga0123355_10000744 3300009826 Bacteria 44411
87 Ga0123355_10007714 3300009826 Bacteria 16169
88 Ga0123355_10035451 3300009826 Unclassified 8108
89 Ga0123356_10123292 3300010049 Bacteria 2525
90 Ga0123353_10025195 3300010167 Bacteria 9056
91 Ga0123353_10080099 3300010167 Bacteria 5253
92 Ga0123353_10422066 3300010167 Bacteria 1976
93 Ga0466711_325880 3300042615 Unclassified 18268
94 Ga0466715_096224 3300042616 Unclassified 5850
95 Ga0466715_623361 3300042616 Bacteria 6097
96 Ga0466723_296224 3300042618 Archaea 4922
97 Ga0466723_318515 3300042618 Bacteria 4725
98 Ga0466723_338195 3300042618 Unclassified 3839
99 Ga0466728_347310 3300042620 Unclassified 9307
100 Ga0466728_477692 3300042620 Bacteria 2225
101 Ga0466719_106003 3300042606 Bacteria 17232
102 Ga0466729_253898 3300042621 Bacteria 37673
103 Ga0466709_185139 3300042648 Bacteria 2058
104 Ga0466708_033771 3300042652 Bacteria 71688
105 Ga0466691_072180 3300042593 Bacteria 5167
106 Ga0123357_10127401 3300009784 Bacteria 3184
107 Ga0123355_10000876 3300009826 Bacteria 41618
108 Ga0123355_10003645 3300009826 Bacteria 22187
109 Ga0123355_10187405 3300009826 Unclassified 3056
110 Ga0123353_10102136 3300010167 Bacteria 4622
111 Ga0123353_10242187 3300010167 Bacteria 2801
112 Ga0123354_10001235 3300010882 Bacteria 30314
113 Ga0123354_10023778 3300010882 Bacteria 9662
114 Ga0466723_147826 3300042618 Bacteria 8985
115 Ga0466728_321460 3300042620 Bacteria 13543
116 JGI24696J40584_12957999 3300002834 Bacteria 3816
117 Ga0123357_10002867 3300009784 Bacteria 19437
118 Ga0123357_10002877 3300009784 Bacteria 19403
119 Ga0466706_129705 3300042599 Bacteria 95744
120 Ga0466731_085033 3300042622 Bacteria 2043
121 Ga0466735_049486 3300042624 Bacteria 20553
122 Ga0466735_066743 3300042624 Bacteria 5919
123 Ga0466703_311623 3300042636 Bacteria 7012
124 Ga0466703_406352 3300042636 Bacteria 10089
125 Ga0466704_098294 3300042643 Bacteria 3276
126 Ga0466708_009376 3300042652 Bacteria 5476
127 Ga0466705_262734 3300042612 Bacteria 37553
128 Ga0466705_356271 3300042612 Bacteria 1510
129 Ga0466656_274446 3300042550 Bacteria 1817
130 Ga0466657_361226 3300042582 Bacteria 6005
131 Ga0466692_204980 3300042591 Bacteria 2618
132 Ga0466691_212247 3300042593 Unclassified 2638
133 Ga0123356_10001427 3300010049 Bacteria 26432
134 Ga0123353_10093569 3300010167 Bacteria 4843
135 Ga0466711_004089 3300042615 Bacteria 32226
136 Ga0466711_181895 3300042615 Bacteria 3435
137 Ga0466711_224592 3300042615 Bacteria 117488
138 Ga0466715_593323 3300042616 Bacteria 37439
139 Ga0466723_015824 3300042618 Bacteria 4937
140 JGI24702J35022_10004011 3300002462 Bacteria 8826
141 Ga0466706_002209 3300042599 Bacteria 2087
142 Ga0466707_039849 3300042601 Bacteria 99110
143 Ga0466716_002899 3300042605 Bacteria 2702
144 Ga0466716_179235 3300042605 Bacteria 2991
145 Ga0466719_506687 3300042606 Bacteria 2376
146 Ga0466722_062339 3300042609 Bacteria 15817
147 Ga0466722_239735 3300042609 Bacteria 1370
148 Ga0466731_129529 3300042622 Bacteria 1723
149 Ga0466735_083747 3300042624 Bacteria 1672
150 Ga0466730_020158 3300042625 Bacteria 2297
151 Ga0466704_089014 3300042643 Bacteria 2607
152 Ga0466704_174348 3300042643 Bacteria 3272
153 Ga0466704_317186 3300042643 Unclassified 10032
154 Ga0466704_558407 3300042643 Bacteria 2001
155 Ga0466708_222599 3300042652 Bacteria 16575
156 Ga0466708_337235 3300042652 Bacteria 4487

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_235431 Ga0466717_235431_739_1827 362
2 3300042612 Ga0466705_356271 Ga0466705_356271_382_1470 362
3 3300042612 Ga0466705_428617 Ga0466705_428617_2913_4082 369
4 3300009826 Ga0123355_10222487 Ga0123355_102224871 397
5 3300010049 Ga0123356_10123292 Ga0123356_101232921 397
6 3300042648 Ga0466709_185139 Ga0466709_185139_701_1921 406
7 3300042652 Ga0466708_222599 Ga0466708_222599_2696_3916 406
8 3300010167 Ga0123353_10422066 Ga0123353_104220662 408
9 3300009826 Ga0123355_10000876 Ga0123355_1000087639 409
10 3300010049 Ga0123356_10034337 Ga0123356_100343372 410
11 3300010167 Ga0123353_10025195 Ga0123353_100251952 410
12 3300042605 Ga0466716_171514 Ga0466716_171514_4834_6090 410
13 3300042620 Ga0466728_321460 Ga0466728_321460_207_1469 410
14 3300042620 Ga0466728_347310 Ga0466728_347310_1652_2914 410
15 3300042625 Ga0466730_020158 Ga0466730_020158_829_2061 410
16 3300042636 Ga0466703_311623 Ga0466703_311623_396_1649 410
17 3300010167 Ga0123353_10010945 Ga0123353_100109457 411
18 3300042590 Ga0466690_023087 Ga0466690_023087_5001_6239 412
19 3300042602 Ga0466713_097113 Ga0466713_097113_44836_46074 412
20 3300042624 Ga0466735_049486 Ga0466735_049486_10345_11649 412
21 3300042612 Ga0466705_190546 Ga0466705_190546_4936_6192 413
22 3300042609 Ga0466722_083333 Ga0466722_083333_36500_37744 414
23 iso_pr_bacteria 2820405014 2820405681 414
24 3300010167 Ga0123353_10093569 Ga0123353_100935696 415
25 3300010167 Ga0123353_10102136 Ga0123353_101021362 415
26 3300010167 Ga0123353_10242187 Ga0123353_102421872 415
27 3300010882 Ga0123354_10023778 Ga0123354_100237783 415
28 3300042600 Ga0466700_389913 Ga0466700_389913_898_2145 415
29 iso_pr_bacteria 2820403592 2820404335 415
30 3300010882 Ga0123354_10087679 Ga0123354_100876792 416
31 3300042655 Ga0466727_006635 Ga0466727_006635_7417_8667 416
32 iso_pr_bacteria 2820001644 2820003377 416
33 3300042609 Ga0466722_239735 Ga0466722_239735_82_1335 417
34 3300042615 Ga0466711_181895 Ga0466711_181895_384_1637 417
35 3300042615 Ga0466711_325880 Ga0466711_325880_11012_12265 417
36 3300042636 Ga0466703_407813 Ga0466703_407813_100325_101578 417
37 3300042643 Ga0466704_463811 Ga0466704_463811_62_1315 417
38 iso_pr_bacteria 2820729191 2820730633 417
39 2225789004 2227477706 2227932266 418
40 3300002462 JGI24702J35022_10039862 JGI24702J35022_100398622 418
41 3300010049 Ga0123356_10002894 Ga0123356_100028945 418
42 3300010049 Ga0123356_10007223 Ga0123356_100072239 418
43 3300042550 Ga0466656_274446 Ga0466656_274446_200_1456 418
44 3300042582 Ga0466657_361226 Ga0466657_361226_123_1379 418
45 3300042591 Ga0466692_204980 Ga0466692_204980_223_1479 418
46 3300042593 Ga0466691_213478 Ga0466691_213478_711_1982 418
47 3300042596 Ga0466696_257149 Ga0466696_257149_921_2177 418
48 3300042599 Ga0466706_129705 Ga0466706_129705_27444_28700 418
49 3300042603 Ga0466714_032663 Ga0466714_032663_21429_22685 418
50 3300042605 Ga0466716_290801 Ga0466716_290801_125_1381 418
51 3300042606 Ga0466719_491287 Ga0466719_491287_131_1387 418
52 3300042612 Ga0466705_151951 Ga0466705_151951_13933_15189 418
53 3300042612 Ga0466705_178218 Ga0466705_178218_13165_14421 418
54 3300042615 Ga0466711_224592 Ga0466711_224592_79626_80882 418
55 3300042616 Ga0466715_096224 Ga0466715_096224_3805_5061 418
56 3300042616 Ga0466715_271792 Ga0466715_271792_3543_4799 418
57 3300042616 Ga0466715_445165 Ga0466715_445165_345_1601 418
58 3300042618 Ga0466723_015824 Ga0466723_015824_3301_4557 418
59 3300042618 Ga0466723_318515 Ga0466723_318515_3375_4631 418
60 3300042618 Ga0466723_367685 Ga0466723_367685_6148_7404 418
61 3300042619 Ga0466726_077587 Ga0466726_077587_27966_29222 418
62 3300042620 Ga0466728_406814 Ga0466728_406814_67_1323 418
63 3300042643 Ga0466704_089014 Ga0466704_089014_792_2048 418
64 3300042643 Ga0466704_174348 Ga0466704_174348_1568_2824 418
65 3300042643 Ga0466704_317186 Ga0466704_317186_1839_3095 418
66 3300042643 Ga0466704_566659 Ga0466704_566659_801_2057 418
67 3300042652 Ga0466708_337235 Ga0466708_337235_808_2064 418
68 3300042659 Ga0466733_058503 Ga0466733_058503_3826_5082 418
69 iso_pr_bacteria 2754412482 2755215937 418
70 iso_pr_bacteria 2754412483 2755217628 418
71 iso_pr_bacteria 2772190889 2773431481 418
72 iso_pr_bacteria 2772190891 2773435005 418
73 iso_pr_bacteria 2772190892 2773435548 418
74 iso_pr_bacteria 2772190893 2773437120 418
75 iso_pr_bacteria 2772190894 2773440124 418
76 iso_pr_bacteria 2772190895 2773440390 418
77 iso_pr_bacteria 2820856540 2820857495 418
78 3300002462 JGI24702J35022_10004011 JGI24702J35022_100040113 419
79 3300002504 JGI24705J35276_12238696 JGI24705J35276_1223869628 419
80 3300009784 Ga0123357_10002867 Ga0123357_1000286713 419
81 3300009826 Ga0123355_10007714 Ga0123355_1000771413 419
82 3300009826 Ga0123355_10187405 Ga0123355_101874052 419
83 3300010167 Ga0123353_10001172 Ga0123353_1000117228 419
84 3300010167 Ga0123353_10027784 Ga0123353_100277846 419
85 3300010882 Ga0123354_10017718 Ga0123354_100177187 419
86 3300042593 Ga0466691_088455 Ga0466691_088455_11975_13234 419
87 3300042593 Ga0466691_212247 Ga0466691_212247_1021_2280 419
88 3300042599 Ga0466706_155444 Ga0466706_155444_1822_3081 419
89 3300042605 Ga0466716_002899 Ga0466716_002899_205_1464 419
90 3300042605 Ga0466716_179235 Ga0466716_179235_1399_2658 419
91 3300042605 Ga0466716_181897 Ga0466716_181897_1118_2377 419
92 3300042605 Ga0466716_361943 Ga0466716_361943_141_1400 419
93 3300042606 Ga0466719_106003 Ga0466719_106003_263_1522 419
94 3300042606 Ga0466719_435978 Ga0466719_435978_2188_3447 419
95 3300042612 Ga0466705_150221 Ga0466705_150221_3037_4296 419
96 3300042612 Ga0466705_262734 Ga0466705_262734_12725_13984 419
97 3300042612 Ga0466705_269816 Ga0466705_269816_11247_12506 419
98 3300042612 Ga0466705_327500 Ga0466705_327500_5289_6548 419
99 3300042612 Ga0466705_515927 Ga0466705_515927_5308_6567 419
100 3300042615 Ga0466711_004089 Ga0466711_004089_16356_17615 419
101 3300042615 Ga0466711_233252 Ga0466711_233252_6377_7636 419
102 3300042616 Ga0466715_144395 Ga0466715_144395_6443_7702 419
103 3300042616 Ga0466715_593323 Ga0466715_593323_2827_4086 419
104 3300042618 Ga0466723_063624 Ga0466723_063624_18667_19926 419
105 3300042618 Ga0466723_092498 Ga0466723_092498_300_1559 419
106 3300042618 Ga0466723_093023 Ga0466723_093023_2171_3430 419
107 3300042618 Ga0466723_123652 Ga0466723_123652_10283_11542 419
108 3300042618 Ga0466723_125995 Ga0466723_125995_10464_11723 419
109 3300042618 Ga0466723_147826 Ga0466723_147826_6775_8034 419
110 3300042618 Ga0466723_296224 Ga0466723_296224_2032_3291 419
111 3300042618 Ga0466723_338195 Ga0466723_338195_1105_2364 419
112 3300042618 Ga0466723_340182 Ga0466723_340182_1534_2793 419
113 3300042619 Ga0466726_342534 Ga0466726_342534_1126_2385 419
114 3300042620 Ga0466728_165584 Ga0466728_165584_16694_17953 419
115 3300042620 Ga0466728_477692 Ga0466728_477692_907_2166 419
116 3300042622 Ga0466731_129529 Ga0466731_129529_454_1713 419
117 3300042636 Ga0466703_059198 Ga0466703_059198_7389_8648 419
118 3300042636 Ga0466703_406352 Ga0466703_406352_5576_6835 419
119 3300042643 Ga0466704_098294 Ga0466704_098294_1083_2342 419
120 3300042643 Ga0466704_558407 Ga0466704_558407_383_1642 419
121 3300042648 Ga0466709_324654 Ga0466709_324654_351_1610 419
122 3300042652 Ga0466708_008067 Ga0466708_008067_38333_39592 419
123 3300042652 Ga0466708_033771 Ga0466708_033771_53230_54489 419
124 iso_pr_bacteria 2791354839 2791679489 419
125 iso_pr_bacteria 2791354848 2791708947 419
126 iso_pr_bacteria 2791354849 2791710084 419
127 iso_pr_bacteria 2820731983 2820732798 419
128 iso_pr_bacteria 2820733257 2820733898 419
129 iso_pr_bacteria 2820734335 2820734426 419
130 iso_pr_bacteria 2820833147 2820834535 419
131 iso_pr_bacteria 2820870086 2820870906 419
132 iso_pr_bacteria 2820873081 2820873948 419
133 iso_pr_bacteria 2820880921 2820882002 419
134 iso_pr_bacteria 2820893114 2820893589 419
135 iso_pr_bacteria 2820906387 2820906600 419
136 iso_pr_bacteria 2820907832 2820908902 419
137 iso_pr_bacteria 2820934415 2820935362 419
138 iso_pr_bacteria 2820939604 2820940619 419
139 iso_pr_bacteria 2820940989 2820941347 419
140 iso_pr_bacteria 2820942695 2820943299 419
141 iso_pr_bacteria 2821322763 2821323019 419
142 3300002834 JGI24696J40584_12957999 JGI24696J40584_129579993 420
143 3300005071 Ga0068302_10272649 Ga0068302_102726491 420
144 3300009784 Ga0123357_10002877 Ga0123357_100028778 420
145 3300009784 Ga0123357_10007296 Ga0123357_100072968 420
146 3300009784 Ga0123357_10031185 Ga0123357_100311855 420
147 3300009784 Ga0123357_10127401 Ga0123357_101274012 420
148 3300009826 Ga0123355_10000744 Ga0123355_1000074436 420
149 3300009826 Ga0123355_10003645 Ga0123355_1000364517 420
150 3300009826 Ga0123355_10035451 Ga0123355_100354519 420
151 3300009826 Ga0123355_10143128 Ga0123355_101431282 420
152 3300010049 Ga0123356_10001427 Ga0123356_100014276 420
153 3300010167 Ga0123353_10080099 Ga0123353_100800993 420
154 3300010882 Ga0123354_10001235 Ga0123354_1000123525 420
155 3300042590 Ga0466690_193780 Ga0466690_193780_4474_5736 420
156 3300042616 Ga0466715_623361 Ga0466715_623361_574_1836 420
157 3300042621 Ga0466729_253898 Ga0466729_253898_17962_19224 420
158 3300042648 Ga0466709_180278 Ga0466709_180278_2140_3402 420
159 3300042643 Ga0466704_028361 Ga0466704_028361_9886_11151 421
160 3300042643 Ga0466704_228191 Ga0466704_228191_1446_2711 421
161 3300042601 Ga0466707_039849 Ga0466707_039849_77864_79132 422
162 3300042618 Ga0466723_119664 Ga0466723_119664_7784_9052 422
163 3300042618 Ga0466723_232786 Ga0466723_232786_1503_2771 422
164 3300042621 Ga0466729_005173 Ga0466729_005173_4150_5418 422
165 3300042652 Ga0466708_009376 Ga0466708_009376_3527_4795 422
166 3300042652 Ga0466708_204681 Ga0466708_204681_19938_21206 422
167 iso_pr_bacteria 8067071256 8067077724 422
168 3300042599 Ga0466706_002209 Ga0466706_002209_618_1889 423
169 3300042624 Ga0466735_066743 Ga0466735_066743_2577_3848 423
170 3300042624 Ga0466735_234538 Ga0466735_234538_10136_11428 423
171 3300010049 Ga0123356_10014194 Ga0123356_100141946 424
172 3300010049 Ga0123356_10059558 Ga0123356_100595582 424
173 3300042618 Ga0466723_180400 Ga0466723_180400_2072_3349 425
174 3300042616 Ga0466715_622217 Ga0466715_622217_998_2278 426
175 3300042619 Ga0466726_395278 Ga0466726_395278_253_1536 427
176 3300042624 Ga0466735_083747 Ga0466735_083747_253_1539 428
177 3300042596 Ga0466696_415601 Ga0466696_415601_3640_4929 429
178 3300042606 Ga0466719_506687 Ga0466719_506687_518_1807 429
179 3300042609 Ga0466722_062339 Ga0466722_062339_11648_12940 430
180 iso_pr_bacteria 642555172 642791421 431
181 3300010882 Ga0123354_10155410 Ga0123354_101554102 432
182 3300042602 Ga0466713_035394 Ga0466713_035394_24465_25769 434
183 3300042643 Ga0466704_159851 Ga0466704_159851_881_2197 438
184 3300042616 Ga0466715_331047 Ga0466715_331047_172_1491 439
185 3300042621 Ga0466729_186881 Ga0466729_186881_139_1458 439
186 3300042622 Ga0466731_085033 Ga0466731_085033_195_1520 441
187 3300009826 Ga0123355_10000111 Ga0123355_1000011149 443
188 3300042616 Ga0466715_574337 Ga0466715_574337_2171_3682 488
189 3300042593 Ga0466691_072180 Ga0466691_072180_1486_3021 511

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain 278 438 0.99
PF05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase 232 508 0.97
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 295 388 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02826 GO:0051287 NAD binding MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
7r37-assembly1.cif.gz_A Crystal structure of S-adenosyl-L-homocysteine hydrolase from Pyrococcus furiosus in complex with inosine 0.988 94 511
7zd7-assembly1.cif.gz_A Crystal structure of the R24E/E352T double mutant of S-adenosyl-L-homocysteine hydrolase from Synechocystis sp. PCC 6803 cocrystallized with adenosine in the presence of Rb+ cations 0.988 95 507
7zd9-assembly1.cif.gz_A Crystal structure of the E352T mutant of S-adenosyl-L-homocysteine hydrolase from Synechocystis sp. PCC 6803 cocrystallized with adenosine in the presence of Rb+ cations 0.985 95 511
7r3a-assembly3.cif.gz_H Crystal structure of S-adenosyl-L-homocysteine hydrolase from Methanococcus maripaludis in complex with inosine 0.984 97 508
7zd8-assembly1.cif.gz_A Crystal structure of the R24E mutant of S-adenosyl-L-homocysteine hydrolase from Synechocystis sp. PCC 6803 cocrystallized with adenosine in the presence of Rb+ cations 0.983 95 511
IDDescriptionScoreStartEndSuperfamily
af_Q58783_187_343_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9898 283 439 3.40.50.720
3ondB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9673 280 439 3.40.50.720
3x2eA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Adenosylhomocysteinase-like 0.9618 104 491 3.40.50.1480
1a7aB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Adenosylhomocysteinase-like 0.9558 96 278 3.40.50.1480
af_Q9VZX9_81_232_3.40.50.1480 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Adenosylhomocysteinase-like 0.9433 87 229 3.40.50.1480
IDDescriptionScoreStartEndGO Terms
AF-A0A6M1SIB0-F1-model_v4 Uncharacterized/unreviewed 0.9988 288 369

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.