Protein Family IF04873

Metagenome Isolate
122 Members
49 Samples
115 Scaffolds
96.83 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_070653|Ga0466691_070653_532_939
Length
111 aa
Sequence
MLLASCKPGYHRSMCWYCGEAISDTETPGRSMRCGICGKDLRSCRNCRFFLPGSRGDCSETNAEPQADKERGNFCDWFSLNPRFRSASAGEQKSRGAAADAKSAFEGLFKD

📊 Sample Types

Isolate 5.7%
Metagenome 94.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.4%
Kalotermitidae 27.7%
Unclassified 19.1%
Rhinotermitidae 8.5%
Termopsidae 4.3%

🌳 Taxonomy

Archaea 0
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
2 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
3 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
4 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
5 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
6 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
7 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
31 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
35 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
36 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
37 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466702_142590 3300042635 Bacteria 1815
2 Ga0466703_164458 3300042636 Bacteria 1309
3 Ga0466727_113849 3300042655 Bacteria 1283
4 Ga0264413_102406 3300024493 Bacteria 6641
5 Ga0466690_325687 3300042590 Bacteria 6079
6 Ga0466691_070653 3300042593 Bacteria 1706
7 Ga0466694_033406 3300042594 Bacteria 2180
8 Ga0466694_270608 3300042594 Bacteria 1304
9 Ga0466699_333830 3300042597 Bacteria 1279
10 Ga0466712_010120 3300042614 Bacteria 5370
11 Ga0466712_061073 3300042614 Unclassified 3679
12 Ga0466711_045928 3300042615 Bacteria 1094
13 Ga0466718_169441 3300042617 Bacteria 1699
14 Ga0466723_022695 3300042618 Bacteria 15683
15 JGI24698J34947_10003810 3300002449 Bacteria 8215
16 JGI24698J34947_10011181 3300002449 Bacteria 4927
17 JGI24698J34947_10029846 3300002449 Bacteria 2878
18 JGI24698J34947_10041501 3300002449 Bacteria 2370
19 JGI24695J34938_10019173 3300002450 Bacteria 3398
20 Ga0466704_449099 3300042643 Bacteria 67975
21 Ga0466709_118869 3300042648 Bacteria 2233
22 Ga0466722_152166 3300042609 Bacteria 6164
23 Ga0466698_011176 3300042610 Bacteria 17753
24 Ga0466694_041245 3300042594 Bacteria 28390
25 Ga0466699_050454 3300042597 Bacteria 3590
26 Ga0466711_160386 3300042615 Bacteria 4147
27 Ga0466726_029852 3300042619 Bacteria 1382
28 AustNasuHG_c1000381 3300000089 Bacteria 15405
29 JGI24698J34947_10003677 3300002449 Unclassified 8339
30 JGI24700J35501_10929822 3300002508 Bacteria 10309
31 Ga0466702_037282 3300042635 Bacteria 1607
32 Ga0466708_292864 3300042652 Bacteria 5851
33 Ga0466700_461778 3300042600 Bacteria 1164
34 Ga0466719_039449 3300042606 Bacteria 10193
35 Ga0123356_10000788 3300010049 Bacteria 35154
36 Ga0123356_10216903 3300010049 Bacteria 1967
37 Ga0123353_12259681 3300010167 Bacteria 656
38 Ga0466692_158584 3300042591 Bacteria 2305
39 Ga0466712_167627 3300042614 Unclassified 13851
40 Ga0466712_192862 3300042614 Bacteria 9459
41 Ga0466715_419555 3300042616 Bacteria 2852
42 Ga0466718_061544 3300042617 Bacteria 1035
43 Ga0466728_251170 3300042620 Bacteria 1018
44 JGI24698J34947_10006961 3300002449 Bacteria 6219
45 JGI24698J34947_10017416 3300002449 Unclassified 3893
46 JGI24698J34947_10078054 3300002449 Bacteria 1563
47 Ga0466732_017114 3300042656 Bacteria 1219
48 Ga0466708_348829 3300042652 Bacteria 2890
49 Ga0466722_165775 3300042609 Unclassified 12993
50 Ga0123353_11765863 3300010167 Bacteria 771
51 Ga0466699_060657 3300042597 Bacteria 1172
52 Ga0466699_327189 3300042597 Bacteria 8958
53 Ga0466712_210733 3300042614 Unclassified 1782
54 Ga0466715_004908 3300042616 Bacteria 1414
55 Ga0466715_222045 3300042616 Bacteria 16267
56 Ga0466715_348294 3300042616 Bacteria 8924
57 Ga0466718_035266 3300042617 Bacteria 1001
58 JGI24698J34947_10149171 3300002449 Bacteria 974
59 JGI24695J34938_10006586 3300002450 Bacteria 6937
60 JGI24695J34938_10010180 3300002450 Bacteria 5177
61 JGI24699J35502_11132010 3300002509 Unclassified 6273
62 Ga0466727_211129 3300042655 Bacteria 1335
63 Ga0466707_239489 3300042601 Bacteria 1576
64 Ga0466717_134853 3300042604 Bacteria 1064
65 Ga0466722_180270 3300042609 Bacteria 21543
66 Ga0466698_148865 3300042610 Bacteria 1420
67 Ga0466712_162409 3300042614 Bacteria 2022
68 Ga0466712_190252 3300042614 Bacteria 5187
69 JGI24698J34947_10003122 3300002449 Bacteria 8976
70 Ga0072941_1099012 3300005201 Bacteria 1447
71 Ga0466733_136397 3300042659 Bacteria 9540
72 Ga0466716_515684 3300042605 Bacteria 10421
73 Ga0123356_10012628 3300010049 Bacteria 8190
74 Ga0123356_11289924 3300010049 Bacteria 894
75 Ga0123353_10252786 3300010167 Bacteria 2728
76 Ga0466699_107752 3300042597 Bacteria 12714
77 Ga0466712_168509 3300042614 Bacteria 1019
78 Ga0466715_154486 3300042616 Bacteria 10903
79 Ga0466726_476085 3300042619 Bacteria 2282
80 JGI24695J34938_10002883 3300002450 Bacteria 12524
81 JGI24695J34938_10026674 3300002450 Bacteria 2742
82 Ga0072941_1081970 3300005201 Bacteria 6129
83 Ga0466705_060331 3300042612 Bacteria 4947
84 Ga0466733_216898 3300042659 Bacteria 3841
85 Ga0466702_163334 3300042635 Bacteria 1099
86 Ga0466708_085424 3300042652 Bacteria 2208
87 Ga0466713_041901 3300042602 Bacteria 3990
88 Ga0466713_135223 3300042602 Bacteria 7210
89 Ga0466716_215456 3300042605 Bacteria 13755
90 Ga0466719_135362 3300042606 Bacteria 51759
91 Ga0123353_10930785 3300010167 Bacteria 1179
92 Ga0123353_11644727 3300010167 Bacteria 808
93 Ga0264413_107675 3300024493 Bacteria 2843
94 Ga0466690_034257 3300042590 Bacteria 1579
95 Ga0466694_105495 3300042594 Bacteria 6347
96 Ga0466712_001431 3300042614 Bacteria 1083
97 Ga0466718_108588 3300042617 Bacteria 22533
98 Ga0466726_140927 3300042619 Bacteria 3036
99 Ga0072940_1201296 3300005200 Bacteria 1434
100 Ga0072941_1020253 3300005201 Bacteria 5568
101 Ga0466705_146047 3300042612 Bacteria 8415
102 Ga0466729_209850 3300042621 Bacteria 1307
103 Ga0466707_019519 3300042601 Bacteria 1535
104 Ga0466719_404610 3300042606 Bacteria 6017
105 Ga0123356_10550370 3300010049 Bacteria 1315
106 Ga0123356_12335059 3300010049 Bacteria 669
107 Ga0123353_10186850 3300010167 Bacteria 3276
108 Ga0456237_0002138 3300041968 Bacteria 3190
109 Ga0466694_107473 3300042594 Bacteria 12890
110 Ga0466699_305108 3300042597 Bacteria 4404
111 Ga0466718_165376 3300042617 Bacteria 8126
112 JGI24698J34947_10002727 3300002449 Bacteria 9538
113 JGI24698J34947_10267431 3300002449 Bacteria 631
114 JGI24695J34938_10001895 3300002450 Bacteria 16940
115 JGI24702J35022_10001630 3300002462 Bacteria 13908

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_12335059 Ga0123356_123350592 89
2 3300024493 Ga0264413_102406 Ga0264413_1024062 89
3 3300042606 Ga0466719_404610 Ga0466719_404610_5454_5747 89
4 3300042659 Ga0466733_136397 Ga0466733_136397_2966_3235 89
5 3300042612 Ga0466705_146047 Ga0466705_146047_4944_5231 90
6 iso_pr_bacteria 2819994798 2819996157 91
7 3300002508 JGI24700J35501_10929822 JGI24700J35501_109298228 92
8 3300042597 Ga0466699_333830 Ga0466699_333830_478_759 93
9 3300042600 Ga0466700_461778 Ga0466700_461778_804_1088 94
10 3300042604 Ga0466717_134853 Ga0466717_134853_333_617 94
11 3300042610 Ga0466698_148865 Ga0466698_148865_591_875 94
12 3300042619 Ga0466726_476085 Ga0466726_476085_1928_2212 94
13 3300002449 JGI24698J34947_10003810 JGI24698J34947_100038109 95
14 3300002449 JGI24698J34947_10029846 JGI24698J34947_100298462 95
15 3300042590 Ga0466690_325687 Ga0466690_325687_1521_1808 95
16 3300042594 Ga0466694_107473 Ga0466694_107473_7521_7808 95
17 3300042605 Ga0466716_215456 Ga0466716_215456_5973_6260 95
18 3300042618 Ga0466723_022695 Ga0466723_022695_9781_10068 95
19 3300042591 Ga0466692_158584 Ga0466692_158584_380_670 96
20 3300042594 Ga0466694_105495 Ga0466694_105495_1362_1652 96
21 3300042609 Ga0466722_152166 Ga0466722_152166_1068_1358 96
22 3300042609 Ga0466722_180270 Ga0466722_180270_17614_17904 96
23 3300042616 Ga0466715_154486 Ga0466715_154486_3693_3983 96
24 3300042619 Ga0466726_029852 Ga0466726_029852_218_508 96
25 3300042635 Ga0466702_037282 Ga0466702_037282_966_1256 96
26 3300042648 Ga0466709_118869 Ga0466709_118869_622_912 96
27 iso_pr_bacteria 2781125657 2781322724 96
28 3300002450 JGI24695J34938_10001895 JGI24695J34938_1000189515 97
29 3300005200 Ga0072940_1201296 Ga0072940_12012961 97
30 3300010049 Ga0123356_10000788 Ga0123356_1000078834 97
31 3300010167 Ga0123353_12259681 Ga0123353_122596812 97
32 3300041968 Ga0456237_0002138 Ga0456237_0002138_581_874 97
33 3300042590 Ga0466690_034257 Ga0466690_034257_772_1065 97
34 3300042594 Ga0466694_033406 Ga0466694_033406_137_430 97
35 3300042594 Ga0466694_041245 Ga0466694_041245_21014_21307 97
36 3300042594 Ga0466694_270608 Ga0466694_270608_300_593 97
37 3300042597 Ga0466699_050454 Ga0466699_050454_498_791 97
38 3300042597 Ga0466699_060657 Ga0466699_060657_642_935 97
39 3300042597 Ga0466699_107752 Ga0466699_107752_7177_7470 97
40 3300042597 Ga0466699_305108 Ga0466699_305108_2742_3035 97
41 3300042597 Ga0466699_327189 Ga0466699_327189_4611_4904 97
42 3300042601 Ga0466707_019519 Ga0466707_019519_950_1243 97
43 3300042601 Ga0466707_239489 Ga0466707_239489_827_1120 97
44 3300042605 Ga0466716_515684 Ga0466716_515684_9146_9439 97
45 3300042606 Ga0466719_039449 Ga0466719_039449_1793_2086 97
46 3300042606 Ga0466719_135362 Ga0466719_135362_51421_51714 97
47 3300042609 Ga0466722_165775 Ga0466722_165775_5680_5973 97
48 3300042610 Ga0466698_011176 Ga0466698_011176_6757_7050 97
49 3300042612 Ga0466705_060331 Ga0466705_060331_3619_3912 97
50 3300042614 Ga0466712_001431 Ga0466712_001431_339_632 97
51 3300042614 Ga0466712_010120 Ga0466712_010120_76_369 97
52 3300042614 Ga0466712_061073 Ga0466712_061073_3322_3615 97
53 3300042614 Ga0466712_162409 Ga0466712_162409_140_433 97
54 3300042614 Ga0466712_167627 Ga0466712_167627_1656_1949 97
55 3300042614 Ga0466712_168509 Ga0466712_168509_335_628 97
56 3300042614 Ga0466712_190252 Ga0466712_190252_2013_2306 97
57 3300042614 Ga0466712_192862 Ga0466712_192862_4763_5056 97
58 3300042614 Ga0466712_210733 Ga0466712_210733_1223_1516 97
59 3300042615 Ga0466711_045928 Ga0466711_045928_414_707 97
60 3300042615 Ga0466711_160386 Ga0466711_160386_329_622 97
61 3300042616 Ga0466715_222045 Ga0466715_222045_9264_9557 97
62 3300042616 Ga0466715_348294 Ga0466715_348294_4859_5152 97
63 3300042616 Ga0466715_419555 Ga0466715_419555_1553_1846 97
64 3300042617 Ga0466718_035266 Ga0466718_035266_575_868 97
65 3300042617 Ga0466718_061544 Ga0466718_061544_482_775 97
66 3300042617 Ga0466718_108588 Ga0466718_108588_17972_18265 97
67 3300042617 Ga0466718_165376 Ga0466718_165376_7623_7916 97
68 3300042617 Ga0466718_169441 Ga0466718_169441_1196_1489 97
69 3300042619 Ga0466726_140927 Ga0466726_140927_508_801 97
70 3300042620 Ga0466728_251170 Ga0466728_251170_319_612 97
71 3300042621 Ga0466729_209850 Ga0466729_209850_782_1075 97
72 3300042635 Ga0466702_142590 Ga0466702_142590_88_381 97
73 3300042635 Ga0466702_163334 Ga0466702_163334_652_945 97
74 3300042636 Ga0466703_164458 Ga0466703_164458_72_365 97
75 3300042643 Ga0466704_449099 Ga0466704_449099_64639_64932 97
76 3300042652 Ga0466708_085424 Ga0466708_085424_604_897 97
77 3300042652 Ga0466708_292864 Ga0466708_292864_4900_5193 97
78 3300042652 Ga0466708_348829 Ga0466708_348829_2300_2593 97
79 3300042655 Ga0466727_113849 Ga0466727_113849_637_930 97
80 3300042655 Ga0466727_211129 Ga0466727_211129_74_367 97
81 3300042656 Ga0466732_017114 Ga0466732_017114_682_975 97
82 3300042659 Ga0466733_216898 Ga0466733_216898_3135_3428 97
83 iso_pr_bacteria 2781125638 2781284576 97
84 iso_pr_bacteria 2781125647 2781303955 97
85 iso_pr_bacteria 2781125651 2781310341 97
86 iso_pr_bacteria 2781125689 2781426149 97
87 iso_pr_bacteria 2781125692 2781431204 97
88 3300000089 AustNasuHG_c1000381 AustNasuHG_10003814 98
89 3300002449 JGI24698J34947_10002727 JGI24698J34947_100027272 98
90 3300002449 JGI24698J34947_10003122 JGI24698J34947_100031227 98
91 3300002449 JGI24698J34947_10003677 JGI24698J34947_100036772 98
92 3300002449 JGI24698J34947_10006961 JGI24698J34947_100069619 98
93 3300002449 JGI24698J34947_10011181 JGI24698J34947_100111816 98
94 3300002449 JGI24698J34947_10017416 JGI24698J34947_100174165 98
95 3300002449 JGI24698J34947_10041501 JGI24698J34947_100415014 98
96 3300002449 JGI24698J34947_10078054 JGI24698J34947_100780542 98
97 3300002449 JGI24698J34947_10267431 JGI24698J34947_102674311 98
98 3300002450 JGI24695J34938_10002883 JGI24695J34938_100028836 98
99 3300002450 JGI24695J34938_10006586 JGI24695J34938_100065865 98
100 3300002450 JGI24695J34938_10010180 JGI24695J34938_100101803 98
101 3300002450 JGI24695J34938_10019173 JGI24695J34938_100191733 98
102 3300002509 JGI24699J35502_11132010 JGI24699J35502_111320102 98
103 3300005201 Ga0072941_1020253 Ga0072941_10202537 98
104 3300005201 Ga0072941_1081970 Ga0072941_10819705 98
105 3300005201 Ga0072941_1099012 Ga0072941_10990122 98
106 3300010049 Ga0123356_10012628 Ga0123356_100126286 98
107 3300010049 Ga0123356_10216903 Ga0123356_102169033 98
108 3300010049 Ga0123356_10550370 Ga0123356_105503702 98
109 3300010049 Ga0123356_11289924 Ga0123356_112899241 98
110 3300010167 Ga0123353_10186850 Ga0123353_101868506 98
111 3300010167 Ga0123353_10930785 Ga0123353_109307851 98
112 3300010167 Ga0123353_11644727 Ga0123353_116447271 98
113 3300002449 JGI24698J34947_10149171 JGI24698J34947_101491712 99
114 3300010167 Ga0123353_10252786 Ga0123353_102527864 99
115 3300042602 Ga0466713_041901 Ga0466713_041901_2859_3158 99
116 3300042602 Ga0466713_135223 Ga0466713_135223_5705_6004 99
117 3300002462 JGI24702J35022_10001630 JGI24702J35022_100016303 100
118 3300010167 Ga0123353_11765863 Ga0123353_117658631 100
119 3300024493 Ga0264413_107675 Ga0264413_1076753 100
120 3300042616 Ga0466715_004908 Ga0466715_004908_804_1106 100
121 3300002450 JGI24695J34938_10026674 JGI24695J34938_100266744 104
122 3300042593 Ga0466691_070653 Ga0466691_070653_532_939 111

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.61 0.71 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.