Protein Family IF04872

Metagenome Isolate
131 Members
52 Samples
120 Scaffolds
126.85 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_068237|Ga0466691_068237_974_1357
Length
127 aa
Sequence
MTENELSKIVFEAGLKIHRALGPGLLENAYEECLYYELEKKCGLFVEKQKTLPLIYEEVRLDAGYRVDIMVENKLIIEAKSVSELTNLHWAQILTYLKLSHCKLGLLINFNTVLFKDGVRRVINGTL

📊 Sample Types

Isolate 7.6%
Metagenome 92.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 58.0%
Unclassified 14.0%
Kalotermitidae 12.0%
Passalidae 6.0%
Hydrophilidae 4.0%
Elmidae 2.0%
Termopsidae 2.0%
Rhinotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
2 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
3 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
4 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
17 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
23 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
26 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
27 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
30 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
34 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
35 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
36 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
40 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
41 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
46 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
47 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
48 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
49 2820217359 Unclassified Kiritimatiellaeota Nt197P3bin101 Isolate Unclassified
50 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
51 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
52 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0265387_1096196 3300024582 Bacteria 610
2 Ga0415639_014878 3300038395 Unclassified 2162
3 Ga0466695_108734 3300042595 Bacteria 1199
4 Ga0466711_070179 3300042615 Bacteria 6432
5 Ga0123357_10259225 3300009784 Bacteria 1842
6 Ga0123357_10610588 3300009784 Unclassified 831
7 Ga0123356_10888902 3300010049 Bacteria 1062
8 Ga0123353_12326426 3300010167 Bacteria 643
9 Ga0466700_221175 3300042600 Bacteria 6585
10 Ga0466722_126710 3300042609 Bacteria 1644
11 IMNBL1DRAFT_c0011397 3300000062 Bacteria 4154
12 JGI24702J35022_10066219 3300002462 Bacteria 1938
13 JGI24702J35022_10253277 3300002462 Bacteria 1025
14 JGI24696J40584_12502678 3300002834 Bacteria 600
15 Ga0466727_090657 3300042655 Bacteria 23400
16 Ga0466727_161533 3300042655 Bacteria 2933
17 Ga0466690_081462 3300042590 Bacteria 1004
18 Ga0466694_140247 3300042594 Bacteria 1658
19 Ga0466699_120865 3300042597 Bacteria 2725
20 Ga0123353_10683812 3300010167 Bacteria 1444
21 Ga0123353_11113668 3300010167 Bacteria 1047
22 Ga0123353_11126560 3300010167 Bacteria 1039
23 Ga0123353_11942505 3300010167 Bacteria 724
24 Ga0123354_10635462 3300010882 Bacteria 768
25 2227068538 2225789003 Unclassified 607
26 2227566609 2225789004 Bacteria 2660
27 IMNBL1DRAFT_c0018893 3300000062 Bacteria 2847
28 Ga0466731_005319 3300042622 Bacteria 1554
29 Ga0466731_139752 3300042622 Bacteria 1069
30 Ga0466730_085398 3300042625 Bacteria 165939
31 Ga0466732_452318 3300042656 Bacteria 3821
32 Ga0466690_190384 3300042590 Bacteria 7440
33 Ga0466691_068237 3300042593 Bacteria 2110
34 Ga0466695_004919 3300042595 Bacteria 5103
35 Ga0466711_207404 3300042615 Unclassified 1603
36 Ga0123357_10141782 3300009784 Bacteria 2951
37 Ga0123356_10107857 3300010049 Bacteria 2684
38 Ga0123356_10408665 3300010049 Bacteria 1497
39 Ga0123356_11354757 3300010049 Bacteria 873
40 Ga0123356_13506408 3300010049 Bacteria 544
41 Ga0123353_11110905 3300010167 Bacteria 1048
42 Ga0123353_12605266 3300010167 Bacteria 598
43 Ga0466716_018359 3300042605 Bacteria 2311
44 JGI24702J35022_10023312 3300002462 Bacteria 3347
45 Ga0466702_351183 3300042635 Bacteria 1340
46 Ga0466709_026077 3300042648 Bacteria 1085
47 Ga0466725_191735 3300042654 Bacteria 1761
48 Ga0466691_126670 3300042593 Bacteria 6181
49 Ga0466695_192782 3300042595 Bacteria 3810
50 Ga0466710_288975 3300042613 Bacteria 1527
51 Ga0466711_503292 3300042615 Unclassified 3271
52 Ga0123356_10258676 3300010049 Bacteria 1823
53 Ga0123353_10278891 3300010167 Bacteria 2568
54 Ga0123353_11317708 3300010167 Bacteria 936
55 Ga0123353_13434470 3300010167 Unclassified 502
56 Ga0123354_10267702 3300010882 Bacteria 1690
57 Ga0466698_268740 3300042610 Bacteria 2151
58 Ga0466697_047606 3300042611 Bacteria 2884
59 JGI24702J35022_10141016 3300002462 Bacteria 1345
60 Ga0466724_55884 3300042649 Bacteria 1991
61 Ga0466657_300375 3300042582 Bacteria 9572
62 Ga0466699_227849 3300042597 Bacteria 3110
63 Ga0466711_056547 3300042615 Bacteria 1175
64 Ga0466715_174786 3300042616 Bacteria 1180
65 Ga0123357_10302207 3300009784 Bacteria 1614
66 Ga0123356_10008796 3300010049 Bacteria 10002
67 Ga0123356_11054299 3300010049 Bacteria 982
68 Ga0123353_10550556 3300010167 Bacteria 1664
69 Ga0123353_10777258 3300010167 Bacteria 1327
70 Ga0466700_142945 3300042600 Bacteria 1624
71 Ga0466700_155309 3300042600 Bacteria 1231
72 Ga0466720_074076 3300042607 Bacteria 1256
73 2227064280 2225789003 Unclassified 733
74 JGI24705J35276_12014182 3300002504 Bacteria 865
75 JGI24696J40584_12717951 3300002834 Bacteria 756
76 Ga0072941_1094590 3300005201 Bacteria 4042
77 Ga0466734_106080 3300042623 Bacteria 1033
78 Ga0466734_110192 3300042623 Bacteria 1577
79 Ga0466709_284722 3300042648 Bacteria 2424
80 Ga0466733_152774 3300042659 Bacteria 1283
81 Ga0466715_273782 3300042616 Bacteria 2040
82 Ga0123356_10018848 3300010049 Bacteria 6549
83 Ga0123356_10066282 3300010049 Bacteria 3379
84 Ga0123356_11430729 3300010049 Bacteria 851
85 Ga0123353_10285253 3300010167 Bacteria 2532
86 Ga0123353_10644114 3300010167 Bacteria 1502
87 Ga0123353_11230494 3300010167 Bacteria 979
88 Ga0123353_11624664 3300010167 Bacteria 814
89 Ga0466700_241294 3300042600 Bacteria 2037
90 Ga0466717_278652 3300042604 Bacteria 1845
91 Ga0466697_052926 3300042611 Bacteria 1277
92 JGI24702J35022_10384549 3300002462 Bacteria 845
93 Ga0072940_1058817 3300005200 Unclassified 1078
94 Ga0466734_125780 3300042623 Bacteria 2691
95 Ga0123356_10231734 3300010049 Bacteria 1911
96 Ga0123356_10504149 3300010049 Bacteria 1367
97 Ga0123356_13516496 3300010049 Bacteria 543
98 Ga0123353_10560617 3300010167 Bacteria 1645
99 Ga0123353_10733187 3300010167 Bacteria 1379
100 Ga0123353_10777354 3300010167 Bacteria 1327
101 Ga0123353_13002203 3300010167 Bacteria 546
102 Ga0466701_072414 3300042598 Bacteria 1373
103 Ga0466714_145513 3300042603 Bacteria 15989
104 Ga0466698_374143 3300042610 Unclassified 2162
105 JGI24705J35276_11889522 3300002504 Bacteria 743
106 Ga0466734_004231 3300042623 Bacteria 1265
107 Ga0466734_069339 3300042623 Bacteria 1120
108 Ga0466694_223693 3300042594 Bacteria 1562
109 Ga0466694_238396 3300042594 Bacteria 1967
110 Ga0466710_225785 3300042613 Bacteria 1156
111 Ga0466711_170255 3300042615 Bacteria 58662
112 Ga0123356_10574403 3300010049 Bacteria 1290
113 Ga0123356_11542152 3300010049 Unclassified 821
114 Ga0123356_11582516 3300010049 Bacteria 811
115 Ga0123353_10969176 3300010167 Bacteria 1147
116 Ga0123354_10357013 3300010882 Bacteria 1294
117 Ga0466701_053215 3300042598 Bacteria 3145
118 JGI24702J35022_10283312 3300002462 Bacteria 973
119 JGI24705J35276_12059203 3300002504 Bacteria 932
120 Ga0072941_1528084 3300005201 Bacteria 595

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_11624664 Ga0123353_116246642 115
2 2225789004 2227566609 2228108736 125
3 3300010167 Ga0123353_10285253 Ga0123353_102852532 125
4 3300042582 Ga0466657_300375 Ga0466657_300375_554_931 125
5 3300042593 Ga0466691_126670 Ga0466691_126670_5054_5431 125
6 3300042594 Ga0466694_140247 Ga0466694_140247_836_1213 125
7 3300042595 Ga0466695_004919 Ga0466695_004919_1013_1390 125
8 3300042597 Ga0466699_227849 Ga0466699_227849_337_714 125
9 3300042598 Ga0466701_072414 Ga0466701_072414_245_622 125
10 3300042600 Ga0466700_155309 Ga0466700_155309_487_864 125
11 3300042604 Ga0466717_278652 Ga0466717_278652_954_1331 125
12 3300042605 Ga0466716_018359 Ga0466716_018359_1519_1896 125
13 3300042607 Ga0466720_074076 Ga0466720_074076_582_959 125
14 3300042609 Ga0466722_126710 Ga0466722_126710_252_629 125
15 3300042610 Ga0466698_268740 Ga0466698_268740_889_1266 125
16 3300042610 Ga0466698_374143 Ga0466698_374143_930_1307 125
17 3300042611 Ga0466697_047606 Ga0466697_047606_311_688 125
18 3300042613 Ga0466710_288975 Ga0466710_288975_235_612 125
19 3300042615 Ga0466711_056547 Ga0466711_056547_393_770 125
20 3300042616 Ga0466715_174786 Ga0466715_174786_42_419 125
21 3300042616 Ga0466715_174786 Ga0466715_174786_543_920 125
22 3300042623 Ga0466734_004231 Ga0466734_004231_292_669 125
23 3300042623 Ga0466734_106080 Ga0466734_106080_176_553 125
24 3300042623 Ga0466734_125780 Ga0466734_125780_1274_1651 125
25 3300042625 Ga0466730_085398 Ga0466730_085398_59639_60016 125
26 3300042656 Ga0466732_452318 Ga0466732_452318_1585_1962 125
27 3300042659 Ga0466733_152774 Ga0466733_152774_499_876 125
28 iso_pr_bacteria 2820211246 2820212065 125
29 iso_pr_bacteria 2820217359 2820218862 125
30 iso_pr_bacteria 2820741847 2820743403 125
31 iso_pr_bacteria 2820751898 2820752655 125
32 iso_pr_bacteria 2864831662 2864832676 125
33 iso_pr_bacteria 2873600114 2873601196 125
34 iso_pr_bacteria 2873610414 2873611549 125
35 2225789003 2227064280 2227420167 126
36 3300002462 JGI24702J35022_10141016 JGI24702J35022_101410161 126
37 3300002462 JGI24702J35022_10283312 JGI24702J35022_102833121 126
38 3300002462 JGI24702J35022_10384549 JGI24702J35022_103845491 126
39 3300002504 JGI24705J35276_11889522 JGI24705J35276_118895222 126
40 3300002504 JGI24705J35276_12059203 JGI24705J35276_120592032 126
41 3300002834 JGI24696J40584_12717951 JGI24696J40584_127179512 126
42 3300005201 Ga0072941_1094590 Ga0072941_10945904 126
43 3300009784 Ga0123357_10141782 Ga0123357_101417823 126
44 3300010049 Ga0123356_10258676 Ga0123356_102586761 126
45 3300010049 Ga0123356_10574403 Ga0123356_105744033 126
46 3300010049 Ga0123356_10888902 Ga0123356_108889021 126
47 3300010049 Ga0123356_11354757 Ga0123356_113547571 126
48 3300010167 Ga0123353_10278891 Ga0123353_102788912 126
49 3300010167 Ga0123353_10550556 Ga0123353_105505563 126
50 3300010167 Ga0123353_10644114 Ga0123353_106441143 126
51 3300010167 Ga0123353_10683812 Ga0123353_106838122 126
52 3300010167 Ga0123353_11110905 Ga0123353_111109051 126
53 3300010167 Ga0123353_11230494 Ga0123353_112304941 126
54 3300010167 Ga0123353_11317708 Ga0123353_113177083 126
55 3300010167 Ga0123353_12326426 Ga0123353_123264262 126
56 3300010167 Ga0123353_12605266 Ga0123353_126052661 126
57 3300038395 Ga0415639_014878 Ga0415639_014878_529_909 126
58 3300042590 Ga0466690_081462 Ga0466690_081462_296_676 126
59 3300042590 Ga0466690_190384 Ga0466690_190384_908_1288 126
60 3300042594 Ga0466694_223693 Ga0466694_223693_127_507 126
61 3300042594 Ga0466694_238396 Ga0466694_238396_904_1284 126
62 3300042595 Ga0466695_108734 Ga0466695_108734_308_688 126
63 3300042595 Ga0466695_192782 Ga0466695_192782_2645_3025 126
64 3300042597 Ga0466699_120865 Ga0466699_120865_189_569 126
65 3300042598 Ga0466701_053215 Ga0466701_053215_2510_2890 126
66 3300042600 Ga0466700_241294 Ga0466700_241294_1210_1590 126
67 3300042603 Ga0466714_145513 Ga0466714_145513_13314_13694 126
68 3300042611 Ga0466697_052926 Ga0466697_052926_199_579 126
69 3300042615 Ga0466711_070179 Ga0466711_070179_4789_5169 126
70 3300042615 Ga0466711_170255 Ga0466711_170255_2951_3331 126
71 3300042615 Ga0466711_207404 Ga0466711_207404_436_816 126
72 3300042615 Ga0466711_503292 Ga0466711_503292_25_405 126
73 3300042616 Ga0466715_273782 Ga0466715_273782_776_1156 126
74 3300042622 Ga0466731_005319 Ga0466731_005319_973_1353 126
75 3300042622 Ga0466731_139752 Ga0466731_139752_585_965 126
76 3300042623 Ga0466734_110192 Ga0466734_110192_224_604 126
77 3300042635 Ga0466702_351183 Ga0466702_351183_27_407 126
78 3300042648 Ga0466709_026077 Ga0466709_026077_369_749 126
79 3300042648 Ga0466709_284722 Ga0466709_284722_1422_1802 126
80 3300042654 Ga0466725_191735 Ga0466725_191735_835_1215 126
81 3300042655 Ga0466727_161533 Ga0466727_161533_717_1097 126
82 iso_pr_bacteria 2820209022 2820209972 126
83 iso_pr_bacteria 2820753519 2820754163 126
84 iso_pr_bacteria 2820755292 2820755796 126
85 3300002462 JGI24702J35022_10066219 JGI24702J35022_100662192 127
86 3300002462 JGI24702J35022_10253277 JGI24702J35022_102532771 127
87 3300002504 JGI24705J35276_12014182 JGI24705J35276_120141821 127
88 3300005201 Ga0072941_1528084 Ga0072941_15280841 127
89 3300009784 Ga0123357_10259225 Ga0123357_102592252 127
90 3300009784 Ga0123357_10302207 Ga0123357_103022072 127
91 3300009784 Ga0123357_10610588 Ga0123357_106105881 127
92 3300010049 Ga0123356_10008796 Ga0123356_100087966 127
93 3300010049 Ga0123356_10018848 Ga0123356_100188483 127
94 3300010049 Ga0123356_10066282 Ga0123356_100662822 127
95 3300010049 Ga0123356_10107857 Ga0123356_101078572 127
96 3300010049 Ga0123356_10231734 Ga0123356_102317342 127
97 3300010049 Ga0123356_10504149 Ga0123356_105041492 127
98 3300010049 Ga0123356_11054299 Ga0123356_110542993 127
99 3300010049 Ga0123356_11542152 Ga0123356_115421521 127
100 3300010049 Ga0123356_11582516 Ga0123356_115825161 127
101 3300010049 Ga0123356_13506408 Ga0123356_135064081 127
102 3300010049 Ga0123356_13516496 Ga0123356_135164961 127
103 3300010167 Ga0123353_10560617 Ga0123353_105606174 127
104 3300010167 Ga0123353_10733187 Ga0123353_107331872 127
105 3300010167 Ga0123353_10777258 Ga0123353_107772582 127
106 3300010167 Ga0123353_10777354 Ga0123353_107773542 127
107 3300010167 Ga0123353_10969176 Ga0123353_109691762 127
108 3300010167 Ga0123353_11126560 Ga0123353_111265602 127
109 3300010167 Ga0123353_11942505 Ga0123353_119425052 127
110 3300010167 Ga0123353_13434470 Ga0123353_134344701 127
111 3300010882 Ga0123354_10267702 Ga0123354_102677022 127
112 3300010882 Ga0123354_10357013 Ga0123354_103570131 127
113 3300010882 Ga0123354_10635462 Ga0123354_106354622 127
114 3300024582 Ga0265387_1096196 Ga0265387_10961962 127
115 3300042593 Ga0466691_068237 Ga0466691_068237_974_1357 127
116 3300042600 Ga0466700_142945 Ga0466700_142945_1225_1608 127
117 3300002834 JGI24696J40584_12502678 JGI24696J40584_125026781 128
118 3300010049 Ga0123356_10408665 Ga0123356_104086652 128
119 3300010167 Ga0123353_13002203 Ga0123353_130022031 128
120 3300002462 JGI24702J35022_10023312 JGI24702J35022_100233121 129
121 3300010167 Ga0123353_11113668 Ga0123353_111136683 129
122 3300042600 Ga0466700_221175 Ga0466700_221175_3976_4365 129
123 2225789003 2227068538 2227428248 130
124 3300000062 IMNBL1DRAFT_c0018893 IMNBL1DRAFT_00188933 131
125 3300042655 Ga0466727_090657 Ga0466727_090657_4432_4827 131
126 3300005200 Ga0072940_1058817 Ga0072940_10588171 134
127 3300042623 Ga0466734_069339 Ga0466734_069339_456_875 139
128 3300000062 IMNBL1DRAFT_c0011397 IMNBL1DRAFT_00113972 142
129 3300010049 Ga0123356_11430729 Ga0123356_114307292 142
130 3300042649 Ga0466724_55884 Ga0466724_55884_1112_1546 144
131 3300042613 Ga0466710_225785 Ga0466710_225785_178_627 149

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13366 PDDEXK_3 PD-(D/E)XK nuclease superfamily 5 122 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.