Protein Family IF04869

Metagenome Isolate
143 Members
74 Samples
99 Scaffolds
236.36 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_061030|Ga0466691_061030_2528_3322
Length
264 aa
Sequence
MKCIIVDDEPIARRGIKKLVEQNPVLELSDTFNSAEAAAVFMKSRQVDLVFLDIQMPGISGIEFAGSIPKTTLVIFTTAFTEYALDSYEVDAIAYLVKPVEADKFRKAVDKAIAYHSLLLDEEKKSLENTGDDCIFVKSERRYFRVNLKDILFVEGLKDYVILQLDGQRIITRMSLKSVQELLPADRFLRINRSYIVNRERIDSFDNNDAFIQSHEIAIGNSYRNLFFEELMGKGRVKITILLLPYLPELDTRQPLRTSGYGFF

📊 Sample Types

Isolate 30.1%
Metagenome 69.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 28.8%
Kalotermitidae 17.8%
Unclassified 9.6%
Termitidae 8.2%
Rhinotermitidae 6.8%
Elmidae 6.8%
Armadillidiidae 5.5%
Drosophilidae 4.1%
Passalidae 2.7%
Apidae 2.7%
Hydrophilidae 2.7%
Tenebrionidae 1.4%
Culicidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
3 2832372155 Apibacter adventoris wkB301 Isolate Apidae
4 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
5 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
6 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
7 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
8 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
9 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
10 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
11 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
12 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
13 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
14 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
15 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
18 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
21 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
22 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
23 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
33 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
34 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
35 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
36 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
37 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
38 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
39 3004672520 Bacteroides sp. 51 Isolate Blattidae
40 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
41 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
42 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
43 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
45 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
46 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
47 3004667792 Bacteroides sp. 519 Isolate Blattidae
48 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
49 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
50 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
51 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
52 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
53 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
54 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
55 2922326829 Bacteroides sp. 224 Isolate Blattidae
56 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
57 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
58 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
59 3300005308 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 1 gut Metagenome Drosophilidae
60 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
61 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
62 2832343623 Apibacter adventoris wkB180 Isolate Apidae
63 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
64 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
65 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
66 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
67 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
68 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
69 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
70 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
71 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
72 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
73 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
74 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_115521 3300042659 Bacteria 4792
2 Ga0466733_178434 3300042659 Unclassified 2903
3 Ga0466733_221565 3300042659 Bacteria 17162
4 Ga0160470_102404 3300012813 Bacteria 3546
5 Ga0160467_103109 3300012829 Bacteria 3023
6 Ga0466723_120598 3300042618 Bacteria 7842
7 Ga0466729_140458 3300042621 Unclassified 10434
8 Ga0466709_168448 3300042648 Bacteria 24997
9 Ga0466713_091714 3300042602 Bacteria 189911
10 Ga0466733_117754 3300042659 Bacteria 7100
11 Ga0466691_061030 3300042593 Bacteria 4359
12 Ga0466696_438390 3300042596 Bacteria 18049
13 Ga0466705_474341 3300042612 Bacteria 80430
14 Ga0466703_319661 3300042636 Bacteria 11976
15 Ga0466704_184109 3300042643 Bacteria 2236
16 Ga0466709_278062 3300042648 Bacteria 13010
17 Ga0466709_294543 3300042648 Bacteria 4139
18 Ga0466706_191496 3300042599 Bacteria 3463
19 Ga0466707_393075 3300042601 Bacteria 10069
20 Ga0466713_057950 3300042602 Bacteria 11972
21 Ga0466719_053867 3300042606 Unclassified 9508
22 Ga0466722_021060 3300042609 Bacteria 1807
23 Ga0068305_10198080 3300005083 Unclassified 2306
24 Ga0074310_1021054 3300005308 Bacteria 1592
25 Ga0466705_191266 3300042612 Bacteria 24237
26 Ga0160443_100131 3300012848 Bacteria 111815
27 Ga0466691_001697 3300042593 Bacteria 4836
28 Ga0466696_041806 3300042596 Bacteria 9300
29 Ga0466696_177143 3300042596 Unclassified 1085
30 Ga0466711_156092 3300042615 Bacteria 8347
31 Ga0466715_619168 3300042616 Bacteria 7830
32 Ga0466703_190886 3300042636 Bacteria 1543
33 Ga0466704_262732 3300042643 Bacteria 4408
34 Ga0466704_294990 3300042643 Bacteria 2391
35 Ga0466709_133488 3300042648 Bacteria 69029
36 Ga0466713_134989 3300042602 Bacteria 147812
37 Ga0466719_057486 3300042606 Bacteria 25200
38 2227194692 2225789004 Bacteria 7872
39 Ga0074310_1126075 3300005308 Bacteria 1577
40 Ga0104045_1004398 3300007085 Bacteria 2573
41 Ga0160433_100077 3300012846 Bacteria 103687
42 Ga0466690_153772 3300042590 Bacteria 6383
43 Ga0466729_151279 3300042621 Bacteria 5720
44 Ga0466704_072128 3300042643 Bacteria 2878
45 Ga0466704_298474 3300042643 Bacteria 25730
46 Ga0466704_322112 3300042643 Bacteria 12910
47 Ga0466709_375824 3300042648 Bacteria 15389
48 Ga0466713_109457 3300042602 Bacteria 80949
49 IMNBL1DRAFT_c0004266 3300000062 Bacteria 8657
50 Ga0104019_1035047 3300007150 Bacteria 2879
51 Ga0104019_1191487 3300007150 Unclassified 1803
52 Ga0466705_074726 3300042612 Bacteria 1974
53 Ga0466705_084719 3300042612 Bacteria 2799
54 Ga0466733_062323 3300042659 Bacteria 49584
55 Ga0562377_0004 3300056842 Bacteria 3525959
56 Ga0160457_1000843 3300012858 Bacteria 10706
57 Ga0466691_131156 3300042593 Bacteria 21071
58 Ga0466715_003229 3300042616 Bacteria 7536
59 Ga0466723_073709 3300042618 Bacteria 8114
60 Ga0466704_120050 3300042643 Bacteria 1125
61 Ga0466724_09429 3300042649 Bacteria 389876
62 Ga0466714_066533 3300042603 Bacteria 2821
63 Ga0466716_262367 3300042605 Bacteria 8990
64 2227097469 2225789004 Bacteria 9704
65 IMNBL1DRAFT_c0000275 3300000062 Bacteria 45397
66 Ga0466733_003794 3300042659 Bacteria 34484
67 Ga0466733_086839 3300042659 Bacteria 20556
68 Ga0466733_216697 3300042659 Bacteria 189231
69 Ga0466715_541548 3300042616 Unclassified 5872
70 Ga0466704_287925 3300042643 Bacteria 11633
71 Ga0466704_316040 3300042643 Bacteria 19712
72 Ga0466704_611298 3300042643 Unclassified 3565
73 Ga0466708_395678 3300042652 Bacteria 1312
74 Ga0466701_036115 3300042598 Bacteria 39022
75 IMNBL1DRAFT_c0027550 3300000062 Bacteria 2134
76 Ga0466705_270455 3300042612 Bacteria 3854
77 Ga0466733_012468 3300042659 Bacteria 49821
78 Ga0466733_019214 3300042659 Bacteria 126944
79 Ga0466733_206038 3300042659 Bacteria 4867
80 Ga0160453_100015 3300012814 Bacteria 282454
81 Ga0466701_009529 3300042598 Bacteria 375690
82 Ga0466711_126967 3300042615 Bacteria 6563
83 Ga0466729_112017 3300042621 Bacteria 1206
84 Ga0466731_294381 3300042622 Bacteria 1160
85 Ga0466730_021757 3300042625 Bacteria 584842
86 Ga0466703_150468 3300042636 Bacteria 6593
87 Ga0466709_215706 3300042648 Bacteria 50492
88 Ga0466719_402663 3300042606 Bacteria 1683
89 Ga0466722_041013 3300042609 Unclassified 2224
90 2227654359 2225789004 Bacteria 1984
91 Ga0466705_078006 3300042612 Bacteria 3949
92 Ga0466733_091037 3300042659 Bacteria 6454
93 Ga0160443_100015 3300012848 Bacteria 436093
94 Ga0466705_439145 3300042612 Bacteria 6161
95 Ga0466703_062171 3300042636 Bacteria 2112
96 Ga0466704_051808 3300042643 Bacteria 24293
97 Ga0466704_052032 3300042643 Unclassified 2127
98 Ga0104045_1001650 3300007085 Bacteria 3108
99 Ga0104045_1080783 3300007085 Unclassified 1172

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_541548 Ga0466715_541548_813_1535 205
2 3300042602 Ga0466713_109457 Ga0466713_109457_63979_64701 212
3 3300042648 Ga0466709_133488 Ga0466709_133488_38594_39316 212
4 3300005083 Ga0068305_10198080 Ga0068305_101980802 213
5 3300042606 Ga0466719_402663 Ga0466719_402663_620_1261 213
6 3300042598 Ga0466701_009529 Ga0466701_009529_233505_234230 218
7 3300042605 Ga0466716_262367 Ga0466716_262367_4579_5298 218
8 3300042616 Ga0466715_003229 Ga0466715_003229_906_1622 221
9 3300042602 Ga0466713_057950 Ga0466713_057950_10095_10817 222
10 3300042648 Ga0466709_375824 Ga0466709_375824_6372_7088 223
11 3300042616 Ga0466715_619168 Ga0466715_619168_1935_2657 232
12 3300042622 Ga0466731_294381 Ga0466731_294381_155_868 232
13 2225789004 2227194692 2227618012 234
14 3300042603 Ga0466714_066533 Ga0466714_066533_1148_1852 234
15 3300042615 Ga0466711_126967 Ga0466711_126967_5693_6397 234
16 3300042615 Ga0466711_156092 Ga0466711_156092_5820_6545 234
17 3300042648 Ga0466709_278062 Ga0466709_278062_6892_7596 234
18 3300042659 Ga0466733_115521 Ga0466733_115521_3264_3968 234
19 3300000062 IMNBL1DRAFT_c0027550 IMNBL1DRAFT_00275503 235
20 3300042590 Ga0466690_153772 Ga0466690_153772_3488_4195 235
21 3300042593 Ga0466691_131156 Ga0466691_131156_1773_2480 235
22 3300042596 Ga0466696_177143 Ga0466696_177143_352_1059 235
23 3300042601 Ga0466707_393075 Ga0466707_393075_6297_7004 235
24 3300042609 Ga0466722_041013 Ga0466722_041013_706_1413 235
25 3300042612 Ga0466705_084719 Ga0466705_084719_1843_2550 235
26 3300042618 Ga0466723_073709 Ga0466723_073709_3074_3781 235
27 3300042621 Ga0466729_140458 Ga0466729_140458_4438_5145 235
28 3300042636 Ga0466703_190886 Ga0466703_190886_403_1110 235
29 3300042636 Ga0466703_319661 Ga0466703_319661_591_1298 235
30 3300042643 Ga0466704_052032 Ga0466704_052032_677_1384 235
31 3300042643 Ga0466704_262732 Ga0466704_262732_1759_2466 235
32 3300042643 Ga0466704_611298 Ga0466704_611298_2809_3516 235
33 3300042648 Ga0466709_168448 Ga0466709_168448_23464_24171 235
34 3300042648 Ga0466709_294543 Ga0466709_294543_233_940 235
35 3300042659 Ga0466733_019214 Ga0466733_019214_43743_44450 235
36 iso_pr_bacteria 3004667792 3004668964 235
37 3300005308 Ga0074310_1021054 Ga0074310_10210542 236
38 3300042612 Ga0466705_191266 Ga0466705_191266_914_1624 236
39 3300042612 Ga0466705_439145 Ga0466705_439145_4358_5068 236
40 3300042612 Ga0466705_474341 Ga0466705_474341_37534_38244 236
41 3300042618 Ga0466723_120598 Ga0466723_120598_2946_3656 236
42 3300042643 Ga0466704_120050 Ga0466704_120050_37_747 236
43 3300042643 Ga0466704_316040 Ga0466704_316040_5083_5793 236
44 3300042643 Ga0466704_322112 Ga0466704_322112_4725_5435 236
45 3300042659 Ga0466733_003794 Ga0466733_003794_28695_29405 236
46 3300042659 Ga0466733_012468 Ga0466733_012468_35702_36412 236
47 3300042659 Ga0466733_062323 Ga0466733_062323_46766_47476 236
48 3300042659 Ga0466733_117754 Ga0466733_117754_3547_4257 236
49 3300042659 Ga0466733_206038 Ga0466733_206038_1996_2706 236
50 3300056842 Ga0562377_0004 Ga0562377_0004_997155_997865 236
51 iso_pr_bacteria 2609459943 2610740868 236
52 iso_pr_bacteria 2830041218 2830044015 236
53 iso_pr_bacteria 2832343623 2832345904 236
54 iso_pr_bacteria 2832372155 2832373252 236
55 iso_pr_bacteria 2873600114 2873601187 236
56 iso_pr_bacteria 2873610414 2873611540 236
57 iso_pr_bacteria 2910926975 2910928738 236
58 iso_pr_bacteria 2940199050 2940201847 236
59 iso_pr_bacteria 2940205530 2940207934 236
60 iso_pr_bacteria 2940212447 2940214849 236
61 iso_pr_bacteria 2940298504 2940300903 236
62 iso_pr_bacteria 2940302308 2940304705 236
63 iso_pr_bacteria 2940306115 2940308288 236
64 iso_pr_bacteria 2940309933 2940312128 236
65 iso_pr_bacteria 2940313741 2940315918 236
66 iso_pr_bacteria 2940317558 2940319756 236
67 iso_pr_bacteria 2940321370 2940323339 236
68 iso_pr_bacteria 2940325180 2940327596 236
69 iso_pr_bacteria 2940328985 2940331401 236
70 iso_pr_bacteria 2940332795 2940334970 236
71 iso_pr_bacteria 2940346213 2940348470 236
72 3300000062 IMNBL1DRAFT_c0004266 IMNBL1DRAFT_00042669 237
73 3300012829 Ga0160467_103109 Ga0160467_1031092 237
74 3300012848 Ga0160443_100015 Ga0160443_10001593 237
75 3300042593 Ga0466691_001697 Ga0466691_001697_3152_3865 237
76 3300042602 Ga0466713_091714 Ga0466713_091714_8098_8811 237
77 3300042606 Ga0466719_057486 Ga0466719_057486_17528_18241 237
78 3300042621 Ga0466729_112017 Ga0466729_112017_385_1098 237
79 3300042652 Ga0466708_395678 Ga0466708_395678_53_766 237
80 3300042659 Ga0466733_178434 Ga0466733_178434_1563_2276 237
81 3300042659 Ga0466733_216697 Ga0466733_216697_123299_124012 237
82 iso_pr_bacteria 2695420931 2698108669 237
83 iso_pr_bacteria 2910942425 2910946939 237
84 iso_pr_bacteria 2910949487 2910950607 237
85 iso_pr_bacteria 2940202316 2940204697 237
86 iso_pr_bacteria 8100166142 8100167909 237
87 2225789004 2227097469 2227479314 238
88 2225789004 2227654359 2228251655 238
89 3300007085 Ga0104045_1001650 Ga0104045_10016503 238
90 3300007150 Ga0104019_1191487 Ga0104019_11914871 238
91 3300042602 Ga0466713_134989 Ga0466713_134989_90567_91283 238
92 3300042612 Ga0466705_074726 Ga0466705_074726_533_1249 238
93 3300042612 Ga0466705_270455 Ga0466705_270455_1940_2656 238
94 3300042643 Ga0466704_072128 Ga0466704_072128_1111_1827 238
95 3300042643 Ga0466704_184109 Ga0466704_184109_627_1343 238
96 3300042643 Ga0466704_294990 Ga0466704_294990_1391_2107 238
97 3300042643 Ga0466704_298474 Ga0466704_298474_20486_21202 238
98 3300042659 Ga0466733_086839 Ga0466733_086839_2594_3310 238
99 3300042659 Ga0466733_221565 Ga0466733_221565_4869_5585 238
100 3300056842 Ga0562377_0004 Ga0562377_0004_238635_239351 238
101 iso_pr_bacteria 2910926975 2910929135 238
102 iso_pr_bacteria 2910942425 2910946931 238
103 iso_pr_bacteria 2910949487 2910950615 238
104 3300005308 Ga0074310_1126075 Ga0074310_11260751 239
105 3300007085 Ga0104045_1080783 Ga0104045_10807831 239
106 3300007150 Ga0104019_1035047 Ga0104019_10350472 239
107 3300042596 Ga0466696_041806 Ga0466696_041806_6132_6851 239
108 3300042606 Ga0466719_053867 Ga0466719_053867_1293_2012 239
109 3300042612 Ga0466705_078006 Ga0466705_078006_430_1149 239
110 iso_pr_bacteria 2609459943 2610741816 239
111 iso_pr_bacteria 2830041218 2830042677 239
112 iso_pr_bacteria 2864831662 2864833344 239
113 3300012846 Ga0160433_100077 Ga0160433_10007727 240
114 3300042596 Ga0466696_438390 Ga0466696_438390_681_1403 240
115 3300042625 Ga0466730_021757 Ga0466730_021757_390836_391558 240
116 3300042636 Ga0466703_150468 Ga0466703_150468_5476_6198 240
117 3300042648 Ga0466709_215706 Ga0466709_215706_45249_45971 240
118 3300042649 Ga0466724_09429 Ga0466724_09429_242807_243529 240
119 iso_pr_bacteria 2695420314 2695472443 240
120 iso_pr_bacteria 2864788197 2864788411 240
121 iso_pr_bacteria 2864891731 2864892776 240
122 iso_pr_bacteria 2864923010 2864923224 240
123 iso_pr_bacteria 2864948220 2864948434 240
124 iso_pr_bacteria 3004672520 3004672711 240
125 iso_pr_bacteria 8100166142 8100169752 240
126 3300012858 Ga0160457_1000843 Ga0160457_100084311 241
127 3300042598 Ga0466701_036115 Ga0466701_036115_24811_25536 241
128 3300042659 Ga0466733_091037 Ga0466733_091037_577_1302 241
129 iso_pr_bacteria 2922326829 2922328882 241
130 3300012814 Ga0160453_100015 Ga0160453_100015194 242
131 3300042599 Ga0466706_191496 Ga0466706_191496_505_1233 242
132 3300042621 Ga0466729_151279 Ga0466729_151279_4322_5050 242
133 3300042643 Ga0466704_051808 Ga0466704_051808_9984_10712 242
134 3300042643 Ga0466704_287925 Ga0466704_287925_5488_6216 242
135 3300000062 IMNBL1DRAFT_c0000275 IMNBL1DRAFT_00002756 243
136 3300007085 Ga0104045_1004398 Ga0104045_10043981 243
137 3300012813 Ga0160470_102404 Ga0160470_1024042 243
138 3300012848 Ga0160443_100131 Ga0160443_10013120 244
139 3300042609 Ga0466722_021060 Ga0466722_021060_261_1007 248
140 iso_pr_bacteria 2695420317 2695483703 250
141 iso_pr_bacteria 8100157865 8100160482 250
142 3300042636 Ga0466703_062171 Ga0466703_062171_1015_1779 254
143 3300042593 Ga0466691_061030 Ga0466691_061030_2528_3322 264

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00072 Response_reg Response regulator receiver domain 4 109 0.92
PF04397 LytTR LytTr DNA-binding domain 142 230 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00072 GO:0000160 phosphorelay signal transduction system BP
PF04397 GO:0003677 DNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.52 0.58 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.