Protein Family IF04855

Metagenome Isolate
220 Members
43 Samples
199 Scaffolds
873.36 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_045101|Ga0466691_045101_6252_9200
Length
982 aa
Sequence
MFIDGLYTILIEPIIQIIEVIFMIFSRMLNNGMAVVVVSVAISLLTHPFYMMAEKWRQVERGTQARLARKLRVIKSVFSGDERHLLITACYRQNHYHPVYGLRNSIGLFIQIPFFMAAYICLSNLQVLKGEPFLFIKDLGMPDALIPLWGGVNLLPIVMTLVNCAAAAVYTKGLPKKDAAQLYLMAAVFLALLYDSPAGLVLYWTCNNLFSLAKNIALRVSNSTNKGGSLPLTPAPQAGLPLPPLRGDSPPQRPPSPIPXEGPAPEGIIDAPPPFPAFGEMENMSSSIFDSPVGGYRRNLPLRRHQGKPLWGLVCAVSLSAAFYLLFIFDKGYYVKRAALSGCFILVCFFPAFAALARKIERKYVPASLYAARNGPLFAASALILWVLAGIAIPSGLIGSSVEEFSFIEPFASPVPFVSRTALQAAGIFLLWPAVVYALFSPKVRFYGTLFLAAAGFIALLDTYLFAGNYGYLTITLTLSNDEFSQPFFIVLLEIALVVLAAVGAALLFIRKRKWLFSVQIIALLSLCAFSVFNIVKIQRDFTRYRGMAVESEETLTPVFTFSKTENNVLVVMLDRALSPFIPTIFAEKPELNETLSGFTWYPNCVSLGPVTISAVPSLFGGYEYAPALMGTNNGTPLVEKHNEALLVMPRVFSEHGFRVTVSDPSWANYNYKSDISIYEPYPAIDAVKIIGKYTKHWLEKNRDVRVFDASAFLQYNLLRFSFLRIAPPFLRFFVYDGGRWLAKIGETNRDFSLLTLDEYTALDVLPEITAVDEGEGTLAIITNQLTHEPAFLQAPAYRPAAAVTDRGSGPYAGDAAYHANIAALLLLSRYFAWLKEHDAYDNTRIIITADHGWGSQHDFEGNITLPNGKALVNYNPLYLVKDFNARGPLAVDQSFMTNADTPSLAVEGLIPDPRNPWTGNPIQPDKDNGVTITTSGSWSPDGHAKYAFKIAEDEYLTVHTDIFDPANWSKGKKPTDETDDP

📊 Sample Types

Isolate 3.6%
Metagenome 96.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.1%
Kalotermitidae 34.1%
Unclassified 19.5%
Termopsidae 7.3%
Rhinotermitidae 4.9%

🌳 Taxonomy

Archaea 2
Bacteria 204
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
5 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
6 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
7 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
8 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
9 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
12 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
13 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
14 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
15 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 650716102 Treponema primitia ZAS-2 Isolate Unclassified
20 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
21 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
22 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
29 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
30 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
31 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
32 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
43 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_169004 3300042612 Bacteria 3303
2 Ga0123353_10113306 3300010167 Bacteria 4366
3 Ga0466712_030357 3300042614 Bacteria 33145
4 Ga0466712_118468 3300042614 Bacteria 28270
5 Ga0466712_187386 3300042614 Bacteria 4864
6 Ga0466718_099267 3300042617 Bacteria 15781
7 Ga0466723_036192 3300042618 Bacteria 13182
8 Ga0466726_287333 3300042619 Bacteria 3413
9 Ga0466716_032507 3300042605 Bacteria 12790
10 Ga0466719_106973 3300042606 Bacteria 29739
11 Ga0466720_100415 3300042607 Bacteria 36539
12 Ga0466698_072184 3300042610 Bacteria 11052
13 Ga0264413_102393 3300024493 Bacteria 3323
14 Ga0264413_102434 3300024493 Bacteria 6935
15 Ga0264413_104711 3300024493 Bacteria 6031
16 Ga0264413_143281 3300024493 Bacteria 6386
17 Ga0466690_114973 3300042590 Bacteria 9717
18 Ga0466692_043512 3300042591 Bacteria 12009
19 Ga0466691_151131 3300042593 Archaea 4671
20 Ga0466694_103720 3300042594 Unclassified 17016
21 Ga0466694_231182 3300042594 Bacteria 6356
22 Ga0466696_109621 3300042596 Unclassified 3757
23 Ga0466696_389081 3300042596 Bacteria 8345
24 Ga0072940_1012669 3300005200 Archaea 3096
25 Ga0466704_544743 3300042643 Bacteria 4256
26 Ga0466708_167230 3300042652 Bacteria 4203
27 Ga0466715_472638 3300042616 Bacteria 12106
28 Ga0466715_489021 3300042616 Bacteria 34263
29 Ga0466726_105473 3300042619 Bacteria 10066
30 Ga0466726_443661 3300042619 Bacteria 16333
31 Ga0466716_430140 3300042605 Bacteria 12454
32 Ga0466720_028491 3300042607 Bacteria 76920
33 Ga0466720_034980 3300042607 Bacteria 11699
34 Ga0466722_105400 3300042609 Bacteria 6519
35 Ga0466698_259293 3300042610 Bacteria 15462
36 Ga0264413_116303 3300024493 Bacteria 5766
37 Ga0466690_409375 3300042590 Bacteria 3064
38 Ga0466691_227946 3300042593 Bacteria 22154
39 Ga0466696_143239 3300042596 Bacteria 7794
40 Ga0466699_031858 3300042597 Bacteria 10513
41 Ga0466699_062795 3300042597 Unclassified 5600
42 Ga0466699_118972 3300042597 Bacteria 29522
43 JGI24698J34947_10008989 3300002449 Bacteria 5479
44 JGI24698J34947_10009200 3300002449 Bacteria 5421
45 JGI24695J34938_10000255 3300002450 Bacteria 51460
46 Ga0072941_1062611 3300005201 Bacteria 5683
47 Ga0466703_326039 3300042636 Bacteria 10823
48 Ga0466704_087888 3300042643 Bacteria 9187
49 Ga0466727_195989 3300042655 Bacteria 3377
50 Ga0466705_286208 3300042612 Bacteria 3827
51 Ga0466712_184515 3300042614 Bacteria 4391
52 Ga0466712_307642 3300042614 Bacteria 17229
53 Ga0466711_497257 3300042615 Bacteria 16499
54 Ga0466715_061752 3300042616 Bacteria 8516
55 Ga0466718_127312 3300042617 Bacteria 8677
56 Ga0466728_204312 3300042620 Bacteria 4586
57 Ga0466707_237783 3300042601 Bacteria 5452
58 Ga0466719_148247 3300042606 Bacteria 5206
59 Ga0466722_214445 3300042609 Bacteria 10207
60 Ga0466698_488468 3300042610 Bacteria 10780
61 Ga0264413_136724 3300024493 Bacteria 6436
62 Ga0466690_282935 3300042590 Bacteria 3966
63 Ga0466692_002215 3300042591 Bacteria 38338
64 Ga0466691_117958 3300042593 Bacteria 28278
65 Ga0466694_342275 3300042594 Bacteria 17413
66 Ga0466699_157175 3300042597 Bacteria 55178
67 Ga0466699_164862 3300042597 Bacteria 6446
68 Ga0466699_311467 3300042597 Bacteria 10260
69 JGI24698J34947_10000004 3300002449 Bacteria 62550
70 JGI24698J34947_10000130 3300002449 Bacteria 27577
71 JGI24698J34947_10001459 3300002449 Unclassified 12451
72 Ga0072940_1019011 3300005200 Bacteria 6401
73 Ga0072941_1034143 3300005201 Bacteria 9043
74 Ga0072941_1046581 3300005201 Bacteria 6641
75 Ga0466704_320679 3300042643 Bacteria 3971
76 Ga0466708_102926 3300042652 Unclassified 3708
77 Ga0466727_248278 3300042655 Bacteria 6631
78 Ga0466727_322649 3300042655 Bacteria 7501
79 Ga0466705_219569 3300042612 Bacteria 6727
80 Ga0466712_064023 3300042614 Unclassified 6233
81 Ga0466712_136649 3300042614 Bacteria 51583
82 Ga0466715_032839 3300042616 Bacteria 18047
83 Ga0466715_039329 3300042616 Bacteria 10547
84 Ga0466718_025890 3300042617 Bacteria 19672
85 Ga0466726_382729 3300042619 Bacteria 8857
86 Ga0466728_079530 3300042620 Bacteria 21530
87 Ga0466719_104486 3300042606 Bacteria 8251
88 Ga0466720_021975 3300042607 Bacteria 22180
89 Ga0466720_082596 3300042607 Bacteria 3352
90 Ga0466720_211375 3300042607 Bacteria 60841
91 Ga0264413_112834 3300024493 Bacteria 8149
92 Ga0264413_135160 3300024493 Bacteria 7658
93 Ga0466690_332885 3300042590 Bacteria 3854
94 Ga0466691_109781 3300042593 Bacteria 6037
95 Ga0466694_071384 3300042594 Bacteria 50432
96 Ga0466694_101978 3300042594 Bacteria 4818
97 Ga0466694_125782 3300042594 Bacteria 25946
98 Ga0466696_418445 3300042596 Bacteria 5957
99 Ga0466699_010664 3300042597 Unclassified 3871
100 Ga0466699_047467 3300042597 Bacteria 11573
101 Ga0466699_102883 3300042597 Bacteria 16516
102 Ga0466699_140624 3300042597 Bacteria 9899
103 JGI24695J34938_10000111 3300002450 Bacteria 72830
104 Ga0072941_1064018 3300005201 Bacteria 7231
105 Ga0072941_1336403 3300005201 Bacteria 3379
106 Ga0466703_168962 3300042636 Bacteria 3759
107 Ga0466704_107068 3300042643 Bacteria 5127
108 Ga0466709_140863 3300042648 Bacteria 2825
109 Ga0466705_015287 3300042612 Unclassified 4693
110 Ga0466705_092431 3300042612 Bacteria 6347
111 Ga0466712_035081 3300042614 Bacteria 3474
112 Ga0466712_041086 3300042614 Bacteria 62732
113 Ga0466718_084538 3300042617 Bacteria 33255
114 Ga0466718_140960 3300042617 Unclassified 8940
115 Ga0466723_031628 3300042618 Bacteria 5931
116 Ga0466726_041373 3300042619 Bacteria 9559
117 Ga0466720_178419 3300042607 Bacteria 5234
118 Ga0466722_201715 3300042609 Bacteria 28386
119 Ga0264413_104712 3300024493 Bacteria 9960
120 Ga0264413_125211 3300024493 Bacteria 3845
121 Ga0466692_191219 3300042591 Bacteria 3606
122 Ga0466691_008291 3300042593 Bacteria 7329
123 Ga0466691_045101 3300042593 Bacteria 10425
124 Ga0466694_032428 3300042594 Unclassified 38124
125 Ga0466694_061177 3300042594 Bacteria 10878
126 Ga0466696_154937 3300042596 Bacteria 5418
127 JGI24698J34947_10000289 3300002449 Bacteria 21802
128 JGI24698J34947_10001753 3300002449 Bacteria 11562
129 JGI24698J34947_10025888 3300002449 Bacteria 3120
130 Ga0072941_1019085 3300005201 Bacteria 32127
131 Ga0072941_1036072 3300005201 Bacteria 7680
132 Ga0072941_1069815 3300005201 Bacteria 5074
133 Ga0466703_415986 3300042636 Bacteria 11759
134 Ga0466704_099081 3300042643 Bacteria 4266
135 Ga0466704_141731 3300042643 Bacteria 11972
136 Ga0466704_173000 3300042643 Bacteria 13906
137 Ga0466704_230269 3300042643 Bacteria 3428
138 Ga0466708_009550 3300042652 Bacteria 10521
139 Ga0466705_083961 3300042612 Bacteria 6009
140 Ga0466732_440856 3300042656 Bacteria 3750
141 Ga0466712_018398 3300042614 Bacteria 5486
142 Ga0466712_299659 3300042614 Unclassified 3527
143 Ga0466711_223943 3300042615 Bacteria 11621
144 Ga0466715_302518 3300042616 Bacteria 11190
145 Ga0466723_060727 3300042618 Bacteria 5114
146 Ga0466720_029809 3300042607 Bacteria 15349
147 Ga0466720_043999 3300042607 Bacteria 22878
148 Ga0264413_103766 3300024493 Bacteria 13584
149 Ga0466692_013455 3300042591 Bacteria 3552
150 Ga0466691_050697 3300042593 Bacteria 30471
151 Ga0466699_063124 3300042597 Unclassified 6354
152 AustNasuHG_c1000343 3300000089 Bacteria 16215
153 AustNasuHG_c1002610 3300000089 Bacteria 6505
154 JGI24698J34947_10009631 3300002449 Bacteria 5294
155 JGI24695J34938_10000006 3300002450 Bacteria 141807
156 JGI24695J34938_10002171 3300002450 Bacteria 15309
157 Ga0466735_060500 3300042624 Bacteria 10533
158 Ga0466704_256660 3300042643 Bacteria 11035
159 Ga0466732_364352 3300042656 Bacteria 25000
160 Ga0466712_180228 3300042614 Bacteria 13858
161 Ga0466715_062449 3300042616 Bacteria 13496
162 Ga0466718_139708 3300042617 Bacteria 35662
163 Ga0466726_071493 3300042619 Bacteria 17665
164 Ga0466726_091926 3300042619 Bacteria 8418
165 Ga0466716_265661 3300042605 Bacteria 5239
166 Ga0466720_041453 3300042607 Bacteria 36391
167 Ga0466698_490437 3300042610 Unclassified 3660
168 Ga0264413_101011 3300024493 Bacteria 11928
169 Ga0466690_005605 3300042590 Bacteria 4007
170 Ga0466692_053844 3300042591 Bacteria 6655
171 Ga0466694_109251 3300042594 Bacteria 20981
172 Ga0466696_263241 3300042596 Bacteria 32707
173 AustNasuHG_c1006222 3300000089 Bacteria 4266
174 Ga0072941_1015854 3300005201 Bacteria 7744
175 Ga0466735_090935 3300042624 Bacteria 12411
176 Ga0466704_280972 3300042643 Bacteria 32550
177 Ga0466704_451593 3300042643 Bacteria 5344
178 Ga0466708_052187 3300042652 Bacteria 5195
179 Ga0466708_353797 3300042652 Bacteria 4333
180 Ga0466705_153873 3300042612 Bacteria 12097
181 Ga0466733_161818 3300042659 Bacteria 5882
182 Ga0466712_042724 3300042614 Bacteria 11388
183 Ga0466711_053417 3300042615 Bacteria 6365
184 Ga0466715_114435 3300042616 Bacteria 19834
185 Ga0466715_538135 3300042616 Bacteria 7932
186 Ga0466718_129224 3300042617 Bacteria 36457
187 Ga0466723_108252 3300042618 Bacteria 3501
188 Ga0466713_109771 3300042602 Bacteria 5581
189 Ga0466716_500963 3300042605 Bacteria 31431
190 Ga0466720_029258 3300042607 Bacteria 50082
191 Ga0466720_112435 3300042607 Bacteria 45324
192 Ga0466699_019663 3300042597 Bacteria 9677
193 Ga0466699_422209 3300042597 Bacteria 15817
194 JGI24698J34947_10009030 3300002449 Bacteria 5469
195 JGI24702J35022_10012312 3300002462 Bacteria 4759
196 Ga0466735_082530 3300042624 Bacteria 24525
197 Ga0466703_229382 3300042636 Bacteria 8107
198 Ga0466704_100028 3300042643 Unclassified 4099
199 Ga0466708_091420 3300042652 Bacteria 6041

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_099081 Ga0466704_099081_751_3267 796
2 3300042607 Ga0466720_178419 Ga0466720_178419_763_3303 799
3 3300042648 Ga0466709_140863 Ga0466709_140863_18_2480 805
4 3300042596 Ga0466696_154937 Ga0466696_154937_28_2520 807
5 3300042614 Ga0466712_030357 Ga0466712_030357_18482_21148 810
6 iso_pr_bacteria 2781125690 2781428780 810
7 3300042602 Ga0466713_109771 Ga0466713_109771_2912_5452 811
8 3300042615 Ga0466711_053417 Ga0466711_053417_2703_5324 813
9 3300042636 Ga0466703_229382 Ga0466703_229382_2565_5009 814
10 3300010167 Ga0123353_10113306 Ga0123353_101133063 817
11 iso_pr_bacteria 2781125635 2781278414 819
12 3300042643 Ga0466704_320679 Ga0466704_320679_173_2872 820
13 3300002450 JGI24695J34938_10000111 JGI24695J34938_1000011119 825
14 3300005201 Ga0072941_1015854 Ga0072941_10158542 825
15 3300042614 Ga0466712_184515 Ga0466712_184515_1494_4157 825
16 3300042616 Ga0466715_039329 Ga0466715_039329_3112_5826 825
17 3300042652 Ga0466708_102926 Ga0466708_102926_112_2823 829
18 3300005201 Ga0072941_1046581 Ga0072941_10465814 830
19 3300002450 JGI24695J34938_10000255 JGI24695J34938_100002559 832
20 3300024493 Ga0264413_102434 Ga0264413_1024345 832
21 3300042597 Ga0466699_422209 Ga0466699_422209_1919_4594 833
22 3300042612 Ga0466705_083961 Ga0466705_083961_2422_5133 835
23 3300042659 Ga0466733_161818 Ga0466733_161818_1880_4501 837
24 3300042616 Ga0466715_114435 Ga0466715_114435_16610_19312 839
25 3300042594 Ga0466694_231182 Ga0466694_231182_3549_6245 840
26 3300042614 Ga0466712_307642 Ga0466712_307642_4600_7266 841
27 3300042624 Ga0466735_090935 Ga0466735_090935_8773_11301 842
28 3300042593 Ga0466691_151131 Ga0466691_151131_125_2839 843
29 3300042614 Ga0466712_118468 Ga0466712_118468_9723_12353 843
30 3300002449 JGI24698J34947_10001459 JGI24698J34947_100014597 844
31 3300042620 Ga0466728_079530 Ga0466728_079530_2157_4859 844
32 3300042607 Ga0466720_029258 Ga0466720_029258_23878_26481 845
33 3300042612 Ga0466705_219569 Ga0466705_219569_2289_4904 845
34 3300024493 Ga0264413_104711 Ga0264413_1047114 846
35 3300042597 Ga0466699_031858 Ga0466699_031858_543_3113 847
36 3300042618 Ga0466723_036192 Ga0466723_036192_5775_8450 847
37 3300042652 Ga0466708_009550 Ga0466708_009550_3927_6614 847
38 3300042607 Ga0466720_082596 Ga0466720_082596_13_2625 848
39 3300042607 Ga0466720_100415 Ga0466720_100415_21316_24057 848
40 3300002449 JGI24698J34947_10009200 JGI24698J34947_100092002 849
41 3300005201 Ga0072941_1069815 Ga0072941_10698154 849
42 3300024493 Ga0264413_136724 Ga0264413_1367245 849
43 3300042605 Ga0466716_500963 Ga0466716_500963_14522_17194 849
44 3300042612 Ga0466705_092431 Ga0466705_092431_3749_6298 849
45 3300042607 Ga0466720_034980 Ga0466720_034980_5515_8118 850
46 3300042614 Ga0466712_035081 Ga0466712_035081_690_3320 850
47 3300042590 Ga0466690_409375 Ga0466690_409375_155_2830 851
48 3300042617 Ga0466718_139708 Ga0466718_139708_23012_25720 851
49 3300042597 Ga0466699_010664 Ga0466699_010664_13_2571 852
50 3300042656 Ga0466732_364352 Ga0466732_364352_16890_19505 852
51 3300042596 Ga0466696_143239 Ga0466696_143239_2153_4777 853
52 3300042590 Ga0466690_332885 Ga0466690_332885_257_2932 854
53 3300042593 Ga0466691_008291 Ga0466691_008291_937_3645 855
54 3300042617 Ga0466718_025890 Ga0466718_025890_12230_14899 855
55 3300002450 JGI24695J34938_10000006 JGI24695J34938_10000006114 857
56 3300005201 Ga0072941_1034143 Ga0072941_10341438 857
57 3300042617 Ga0466718_129224 Ga0466718_129224_21403_24090 857
58 3300042643 Ga0466704_107068 Ga0466704_107068_1333_4002 858
59 3300042643 Ga0466704_451593 Ga0466704_451593_2332_5073 858
60 3300042614 Ga0466712_136649 Ga0466712_136649_32150_34846 859
61 3300042617 Ga0466718_084538 Ga0466718_084538_19831_22506 859
62 3300000089 AustNasuHG_c1002610 AustNasuHG_10026103 860
63 3300042616 Ga0466715_062449 Ga0466715_062449_5746_8427 860
64 3300005200 Ga0072940_1019011 Ga0072940_10190112 861
65 3300042614 Ga0466712_042724 Ga0466712_042724_8178_10868 862
66 3300042636 Ga0466703_415986 Ga0466703_415986_42_2663 862
67 3300042655 Ga0466727_322649 Ga0466727_322649_2607_5288 862
68 3300042593 Ga0466691_109781 Ga0466691_109781_2938_5649 863
69 3300042597 Ga0466699_062795 Ga0466699_062795_711_3380 863
70 3300042605 Ga0466716_430140 Ga0466716_430140_9316_11973 863
71 3300042619 Ga0466726_382729 Ga0466726_382729_2554_5232 863
72 3300002449 JGI24698J34947_10025888 JGI24698J34947_100258881 864
73 3300042614 Ga0466712_064023 Ga0466712_064023_2366_5116 864
74 3300042618 Ga0466723_031628 Ga0466723_031628_972_3566 864
75 3300024493 Ga0264413_125211 Ga0264413_1252112 865
76 3300042591 Ga0466692_053844 Ga0466692_053844_865_3507 865
77 3300042610 Ga0466698_072184 Ga0466698_072184_7878_10475 865
78 3300042617 Ga0466718_025890 Ga0466718_025890_8321_11017 865
79 3300042591 Ga0466692_043512 Ga0466692_043512_3666_6362 866
80 3300042619 Ga0466726_443661 Ga0466726_443661_8996_11638 866
81 3300042594 Ga0466694_109251 Ga0466694_109251_7421_10090 867
82 3300042607 Ga0466720_043999 Ga0466720_043999_10020_12644 867
83 3300024493 Ga0264413_101011 Ga0264413_1010115 869
84 3300042593 Ga0466691_117958 Ga0466691_117958_1121_3730 869
85 3300042594 Ga0466694_071384 Ga0466694_071384_3441_6050 869
86 3300042614 Ga0466712_180228 Ga0466712_180228_2332_5007 869
87 3300042619 Ga0466726_041373 Ga0466726_041373_5550_8240 869
88 3300042594 Ga0466694_032428 Ga0466694_032428_14356_17013 870
89 3300042597 Ga0466699_102883 Ga0466699_102883_5931_8600 870
90 3300042615 Ga0466711_223943 Ga0466711_223943_2764_5439 870
91 3300042617 Ga0466718_127312 Ga0466718_127312_1035_3707 870
92 3300042624 Ga0466735_060500 Ga0466735_060500_7695_10418 870
93 3300042606 Ga0466719_148247 Ga0466719_148247_1205_3871 871
94 3300042614 Ga0466712_018398 Ga0466712_018398_1694_4375 871
95 3300042597 Ga0466699_019663 Ga0466699_019663_517_3195 872
96 3300042597 Ga0466699_063124 Ga0466699_063124_435_3113 872
97 3300000089 AustNasuHG_c1006222 AustNasuHG_10062222 873
98 3300002449 JGI24698J34947_10000130 JGI24698J34947_1000013021 873
99 3300042591 Ga0466692_191219 Ga0466692_191219_720_3377 873
100 3300042610 Ga0466698_072184 Ga0466698_072184_5137_7803 873
101 3300002449 JGI24698J34947_10000004 JGI24698J34947_1000000442 874
102 3300042597 Ga0466699_164862 Ga0466699_164862_1375_4050 874
103 3300042616 Ga0466715_489021 Ga0466715_489021_24048_26744 874
104 3300042591 Ga0466692_013455 Ga0466692_013455_685_3384 875
105 3300000089 AustNasuHG_c1000343 AustNasuHG_10003432 876
106 3300042609 Ga0466722_214445 Ga0466722_214445_3706_6393 876
107 3300002449 JGI24698J34947_10009030 JGI24698J34947_100090303 877
108 3300042606 Ga0466719_106973 Ga0466719_106973_21811_24525 877
109 3300005201 Ga0072941_1036072 Ga0072941_10360725 878
110 3300002449 JGI24698J34947_10001753 JGI24698J34947_100017538 879
111 3300024493 Ga0264413_104712 Ga0264413_1047126 879
112 3300042594 Ga0466694_103720 Ga0466694_103720_12626_15334 879
113 3300042607 Ga0466720_041453 Ga0466720_041453_6506_9178 879
114 3300042612 Ga0466705_169004 Ga0466705_169004_284_3019 879
115 3300042643 Ga0466704_230269 Ga0466704_230269_238_2928 879
116 3300042593 Ga0466691_050697 Ga0466691_050697_23012_25699 880
117 3300042607 Ga0466720_211375 Ga0466720_211375_27786_30458 880
118 3300042636 Ga0466703_326039 Ga0466703_326039_7084_9759 880
119 3300024493 Ga0264413_135160 Ga0264413_1351602 881
120 3300042607 Ga0466720_112435 Ga0466720_112435_200_2869 881
121 3300042620 Ga0466728_204312 Ga0466728_204312_221_2938 881
122 3300042609 Ga0466722_105400 Ga0466722_105400_2057_4705 882
123 3300042614 Ga0466712_187386 Ga0466712_187386_1494_4172 882
124 3300042597 Ga0466699_157175 Ga0466699_157175_20425_23094 883
125 3300042597 Ga0466699_118972 Ga0466699_118972_16874_19600 884
126 3300042616 Ga0466715_472638 Ga0466715_472638_2965_5721 884
127 3300042652 Ga0466708_353797 Ga0466708_353797_759_3413 884
128 3300002450 JGI24695J34938_10002171 JGI24695J34938_100021718 886
129 3300042601 Ga0466707_237783 Ga0466707_237783_961_3621 886
130 3300042610 Ga0466698_490437 Ga0466698_490437_627_3353 886
131 3300042655 Ga0466727_195989 Ga0466727_195989_233_2926 886
132 iso_pr_bacteria 2781125635 2781276505 886
133 iso_pr_bacteria 2781125645 2781297672 886
134 3300024493 Ga0264413_116303 Ga0264413_1163032 887
135 3300042590 Ga0466690_114973 Ga0466690_114973_2850_5513 887
136 3300042618 Ga0466723_108252 Ga0466723_108252_287_3001 887
137 3300042636 Ga0466703_168962 Ga0466703_168962_787_3483 887
138 3300042594 Ga0466694_125782 Ga0466694_125782_12425_15091 888
139 3300042607 Ga0466720_112435 Ga0466720_112435_2918_5584 888
140 3300042594 Ga0466694_101978 Ga0466694_101978_338_3007 889
141 3300042596 Ga0466696_263241 Ga0466696_263241_15759_18473 889
142 3300042614 Ga0466712_136649 Ga0466712_136649_28226_30895 889
143 3300042614 Ga0466712_299659 Ga0466712_299659_44_2713 889
144 3300042616 Ga0466715_538135 Ga0466715_538135_4312_7023 889
145 3300042617 Ga0466718_127312 Ga0466718_127312_3744_6413 889
146 3300042619 Ga0466726_071493 Ga0466726_071493_13949_16618 889
147 3300042619 Ga0466726_091926 Ga0466726_091926_3654_6323 889
148 3300042643 Ga0466704_100028 Ga0466704_100028_89_2758 889
149 iso_pr_bacteria 2781125695 2781438930 889
150 3300002462 JGI24702J35022_10012312 JGI24702J35022_100123122 890
151 3300042594 Ga0466694_342275 Ga0466694_342275_4706_7378 890
152 3300042596 Ga0466696_263241 Ga0466696_263241_13094_15790 890
153 3300042617 Ga0466718_140960 Ga0466718_140960_4050_6722 890
154 3300042619 Ga0466726_071493 Ga0466726_071493_11245_13947 890
155 3300042624 Ga0466735_082530 Ga0466735_082530_3569_6292 890
156 iso_pr_bacteria 2781125629 2781262902 890
157 3300002449 JGI24698J34947_10008989 JGI24698J34947_100089892 891
158 3300024493 Ga0264413_102393 Ga0264413_1023932 891
159 3300024493 Ga0264413_112834 Ga0264413_1128344 891
160 3300042597 Ga0466699_047467 Ga0466699_047467_6733_9408 891
161 3300042597 Ga0466699_140624 Ga0466699_140624_5446_8121 891
162 3300042597 Ga0466699_311467 Ga0466699_311467_904_3579 891
163 3300042607 Ga0466720_021975 Ga0466720_021975_11183_13858 891
164 3300042610 Ga0466698_488468 Ga0466698_488468_5797_8472 891
165 3300042612 Ga0466705_015287 Ga0466705_015287_26_2701 891
166 3300042616 Ga0466715_032839 Ga0466715_032839_12341_15121 891
167 3300042624 Ga0466735_060500 Ga0466735_060500_4898_7621 891
168 3300042656 Ga0466732_440856 Ga0466732_440856_682_3357 891
169 3300024493 Ga0264413_101011 Ga0264413_1010113 892
170 3300024493 Ga0264413_103766 Ga0264413_1037665 892
171 3300042605 Ga0466716_032507 Ga0466716_032507_2155_4884 892
172 3300042607 Ga0466720_029809 Ga0466720_029809_1803_4481 892
173 3300042607 Ga0466720_100415 Ga0466720_100415_14789_17467 892
174 3300042612 Ga0466705_286208 Ga0466705_286208_642_3320 892
175 3300042607 Ga0466720_028491 Ga0466720_028491_38196_40895 893
176 3300042610 Ga0466698_259293 Ga0466698_259293_12335_15016 893
177 3300042614 Ga0466712_041086 Ga0466712_041086_16142_18823 893
178 3300042652 Ga0466708_091420 Ga0466708_091420_3200_5947 893
179 3300042612 Ga0466705_153873 Ga0466705_153873_842_3610 894
180 3300005200 Ga0072940_1012669 Ga0072940_10126691 895
181 3300042643 Ga0466704_256660 Ga0466704_256660_5783_8470 895
182 3300024493 Ga0264413_143281 Ga0264413_1432812 896
183 3300042607 Ga0466720_028491 Ga0466720_028491_47662_50352 896
184 3300042643 Ga0466704_280972 Ga0466704_280972_10013_12703 896
185 3300042591 Ga0466692_002215 Ga0466692_002215_23588_26359 897
186 3300042606 Ga0466719_104486 Ga0466719_104486_796_3489 897
187 3300042619 Ga0466726_105473 Ga0466726_105473_2211_4904 897
188 iso_pr_bacteria 650716102 650882373 897
189 3300005201 Ga0072941_1064018 Ga0072941_10640187 898
190 3300005201 Ga0072941_1336403 Ga0072941_13364031 898
191 3300042590 Ga0466690_282935 Ga0466690_282935_196_2892 898
192 3300042643 Ga0466704_544743 Ga0466704_544743_1135_3861 898
193 3300005201 Ga0072941_1062611 Ga0072941_10626114 899
194 3300042655 Ga0466727_248278 Ga0466727_248278_2625_5324 899
195 3300042643 Ga0466704_141731 Ga0466704_141731_5017_7719 900
196 3300042596 Ga0466696_109621 Ga0466696_109621_981_3686 901
197 3300042609 Ga0466722_201715 Ga0466722_201715_2382_5087 901
198 3300042619 Ga0466726_287333 Ga0466726_287333_245_2950 901
199 3300042605 Ga0466716_265661 Ga0466716_265661_1016_3781 902
200 3300002449 JGI24698J34947_10009631 JGI24698J34947_100096312 903
201 3300042643 Ga0466704_173000 Ga0466704_173000_4520_7231 903
202 3300042616 Ga0466715_061752 Ga0466715_061752_207_2921 904
203 3300042617 Ga0466718_099267 Ga0466718_099267_11712_14468 905
204 3300042596 Ga0466696_389081 Ga0466696_389081_123_2846 907
205 3300042616 Ga0466715_302518 Ga0466715_302518_6630_9353 907
206 3300042643 Ga0466704_087888 Ga0466704_087888_5995_8718 907
207 iso_pr_bacteria 650716102 650882375 907
208 3300042590 Ga0466690_005605 Ga0466690_005605_870_3596 908
209 3300042596 Ga0466696_418445 Ga0466696_418445_3046_5772 908
210 3300002449 JGI24698J34947_10000289 JGI24698J34947_100002899 909
211 3300042609 Ga0466722_214445 Ga0466722_214445_6390_9119 909
212 3300042593 Ga0466691_227946 Ga0466691_227946_17893_20628 911
213 3300042615 Ga0466711_497257 Ga0466711_497257_9748_12492 914
214 3300042652 Ga0466708_167230 Ga0466708_167230_661_3405 914
215 3300042594 Ga0466694_061177 Ga0466694_061177_6292_9039 915
216 3300042652 Ga0466708_052187 Ga0466708_052187_804_3554 916
217 3300005201 Ga0072941_1019085 Ga0072941_101908535 920
218 3300042620 Ga0466728_079530 Ga0466728_079530_4838_7612 924
219 3300042618 Ga0466723_060727 Ga0466723_060727_771_3689 957
220 3300042593 Ga0466691_045101 Ga0466691_045101_6252_9200 982

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02096 60KD_IMP 60Kd inner membrane protein 32 217 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.