Protein Family IF04850
Metagenome
Isolate
107
Members
40
Samples
102
Scaffolds
123.79
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_038666|Ga0466691_038666_472_834
- Length
- 120 aa
- Sequence
- MNKRLFALRGATQCRNEAADIILQVSALYDELLDRNTLEERDIVSLIFSVTGDIDAKNPAAALRDSGRGRNLALFAVQEAAMEGLERTIRVLIHCYMPPGTAPRHVYRNGTELLRPDRTA
Sample Types
Isolate
4.7%
Metagenome
95.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.1%
Termitidae
32.4%
Unclassified
16.2%
Termopsidae
10.8%
Rhinotermitidae
5.4%
Taxonomy
Archaea
1
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 2 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 5 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 6 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 31 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 32 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_167082 | 3300042612 | Bacteria | 4378 |
| 2 | Ga0466703_144938 | 3300042636 | Unclassified | 1609 |
| 3 | Ga0466703_302348 | 3300042636 | Bacteria | 10483 |
| 4 | Ga0466708_434581 | 3300042652 | Bacteria | 1934 |
| 5 | Ga0466719_082000 | 3300042606 | Bacteria | 4894 |
| 6 | Ga0466715_021799 | 3300042616 | Bacteria | 20987 |
| 7 | Ga0466728_049460 | 3300042620 | Bacteria | 2855 |
| 8 | Ga0466728_157394 | 3300042620 | Bacteria | 1360 |
| 9 | Ga0466728_317877 | 3300042620 | Bacteria | 4524 |
| 10 | Ga0264413_104764 | 3300024493 | Bacteria | 11561 |
| 11 | Ga0466690_387033 | 3300042590 | Unclassified | 2374 |
| 12 | Ga0466691_103781 | 3300042593 | Bacteria | 26100 |
| 13 | AustNasuHG_c1002498 | 3300000089 | Bacteria | 6658 |
| 14 | Ga0466705_016622 | 3300042612 | Bacteria | 7410 |
| 15 | Ga0466705_364966 | 3300042612 | Bacteria | 2775 |
| 16 | Ga0466700_098597 | 3300042600 | Bacteria | 3720 |
| 17 | Ga0466719_370614 | 3300042606 | Bacteria | 2022 |
| 18 | Ga0123353_10190003 | 3300010167 | Bacteria | 3243 |
| 19 | Ga0466726_229605 | 3300042619 | Bacteria | 4196 |
| 20 | Ga0466726_287770 | 3300042619 | Bacteria | 2161 |
| 21 | Ga0466696_299402 | 3300042596 | Bacteria | 19315 |
| 22 | Ga0466705_122990 | 3300042612 | Bacteria | 1220 |
| 23 | Ga0466703_204521 | 3300042636 | Bacteria | 3435 |
| 24 | Ga0466711_148480 | 3300042615 | Bacteria | 21466 |
| 25 | Ga0466711_383865 | 3300042615 | Bacteria | 70512 |
| 26 | Ga0466718_042044 | 3300042617 | Unclassified | 3037 |
| 27 | Ga0466723_015754 | 3300042618 | Bacteria | 6295 |
| 28 | Ga0466723_045242 | 3300042618 | Bacteria | 4487 |
| 29 | Ga0466723_269196 | 3300042618 | Unclassified | 5613 |
| 30 | Ga0466728_259324 | 3300042620 | Bacteria | 1253 |
| 31 | Ga0466729_117292 | 3300042621 | Unclassified | 1612 |
| 32 | Ga0466692_047119 | 3300042591 | Bacteria | 17119 |
| 33 | Ga0466691_038666 | 3300042593 | Bacteria | 1055 |
| 34 | Ga0466696_137087 | 3300042596 | Bacteria | 42498 |
| 35 | Ga0072940_1032163 | 3300005200 | Bacteria | 2816 |
| 36 | Ga0466705_203653 | 3300042612 | Bacteria | 6454 |
| 37 | Ga0466735_148895 | 3300042624 | Bacteria | 1135 |
| 38 | Ga0466704_145851 | 3300042643 | Bacteria | 6375 |
| 39 | Ga0466704_507153 | 3300042643 | Bacteria | 4262 |
| 40 | Ga0466727_206118 | 3300042655 | Bacteria | 1085 |
| 41 | Ga0466707_357489 | 3300042601 | Bacteria | 1444 |
| 42 | Ga0123356_10125807 | 3300010049 | Unclassified | 2502 |
| 43 | Ga0466711_378858 | 3300042615 | Bacteria | 1825 |
| 44 | Ga0466726_152788 | 3300042619 | Bacteria | 1816 |
| 45 | Ga0466691_196349 | 3300042593 | Bacteria | 25666 |
| 46 | Ga0466696_221432 | 3300042596 | Bacteria | 3570 |
| 47 | JGI24698J34947_10120149 | 3300002449 | Bacteria | 1142 |
| 48 | Ga0072940_1197303 | 3300005200 | Unclassified | 728 |
| 49 | Ga0466735_025271 | 3300042624 | Bacteria | 18955 |
| 50 | Ga0466704_594297 | 3300042643 | Bacteria | 3807 |
| 51 | Ga0466708_156340 | 3300042652 | Bacteria | 9784 |
| 52 | Ga0466708_385450 | 3300042652 | Bacteria | 4170 |
| 53 | Ga0466708_428172 | 3300042652 | Bacteria | 9660 |
| 54 | Ga0466716_316398 | 3300042605 | Bacteria | 17644 |
| 55 | Ga0123353_10389349 | 3300010167 | Unclassified | 2080 |
| 56 | Ga0123353_10587954 | 3300010167 | Bacteria | 1595 |
| 57 | Ga0466715_172769 | 3300042616 | Bacteria | 1109 |
| 58 | Ga0466723_211368 | 3300042618 | Bacteria | 5911 |
| 59 | Ga0466726_252948 | 3300042619 | Bacteria | 1072 |
| 60 | Ga0466693_437327 | 3300042592 | Bacteria | 95896 |
| 61 | Ga0466705_195441 | 3300042612 | Bacteria | 3148 |
| 62 | Ga0466735_152309 | 3300042624 | Bacteria | 1419 |
| 63 | Ga0466702_084450 | 3300042635 | Bacteria | 7096 |
| 64 | Ga0466702_377275 | 3300042635 | Bacteria | 1149 |
| 65 | Ga0466704_478969 | 3300042643 | Bacteria | 4850 |
| 66 | Ga0466719_312121 | 3300042606 | Bacteria | 29475 |
| 67 | Ga0466711_318079 | 3300042615 | Bacteria | 3802 |
| 68 | Ga0466690_157214 | 3300042590 | Unclassified | 2533 |
| 69 | JGI24695J34938_10000135 | 3300002450 | Bacteria | 66811 |
| 70 | Ga0466705_057360 | 3300042612 | Unclassified | 2015 |
| 71 | Ga0466732_214374 | 3300042656 | Bacteria | 6892 |
| 72 | Ga0466702_199616 | 3300042635 | Bacteria | 1796 |
| 73 | Ga0466708_016703 | 3300042652 | Bacteria | 5238 |
| 74 | Ga0466719_249670 | 3300042606 | Bacteria | 1296 |
| 75 | Ga0466711_411482 | 3300042615 | Bacteria | 1535 |
| 76 | Ga0466723_256619 | 3300042618 | Bacteria | 5228 |
| 77 | Ga0466728_109387 | 3300042620 | Bacteria | 15237 |
| 78 | Ga0466728_312247 | 3300042620 | Bacteria | 2661 |
| 79 | Ga0466691_020090 | 3300042593 | Bacteria | 2865 |
| 80 | Ga0466696_393325 | 3300042596 | Bacteria | 5310 |
| 81 | JGI24705J35276_11308826 | 3300002504 | Bacteria | 504 |
| 82 | Ga0466732_120343 | 3300042656 | Bacteria | 4863 |
| 83 | Ga0466729_208508 | 3300042621 | Bacteria | 1304 |
| 84 | Ga0466704_131311 | 3300042643 | Bacteria | 8485 |
| 85 | Ga0466704_137917 | 3300042643 | Bacteria | 6072 |
| 86 | Ga0466704_290914 | 3300042643 | Bacteria | 3481 |
| 87 | Ga0466727_234543 | 3300042655 | Bacteria | 4635 |
| 88 | Ga0466719_034491 | 3300042606 | Bacteria | 17517 |
| 89 | Ga0466719_337717 | 3300042606 | Bacteria | 5060 |
| 90 | Ga0466705_457798 | 3300042612 | Bacteria | 1159 |
| 91 | Ga0466718_064120 | 3300042617 | Unclassified | 6301 |
| 92 | Ga0466723_245776 | 3300042618 | Bacteria | 2153 |
| 93 | Ga0466726_049062 | 3300042619 | Bacteria | 1139 |
| 94 | Ga0466726_147521 | 3300042619 | Bacteria | 4800 |
| 95 | Ga0466726_487118 | 3300042619 | Bacteria | 1190 |
| 96 | Ga0466690_041361 | 3300042590 | Bacteria | 2853 |
| 97 | Ga0466691_120976 | 3300042593 | Bacteria | 5925 |
| 98 | Ga0466696_172696 | 3300042596 | Bacteria | 1031 |
| 99 | FAAS_10426480 | 3300001880 | Bacteria | 542 |
| 100 | Ga0068302_10045198 | 3300005071 | Bacteria | 1559 |
| 101 | Ga0068302_10060245 | 3300005071 | Bacteria | 4352 |
| 102 | Ga0072941_1074982 | 3300005201 | Archaea | 6704 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042600 | Ga0466700_098597 | Ga0466700_098597_3170_3529 | 119 |
| 2 | 3300042606 | Ga0466719_082000 | Ga0466719_082000_1510_1869 | 119 |
| 3 | 3300042606 | Ga0466719_249670 | Ga0466719_249670_147_506 | 119 |
| 4 | 3300042612 | Ga0466705_122990 | Ga0466705_122990_494_853 | 119 |
| 5 | 3300042612 | Ga0466705_457798 | Ga0466705_457798_433_792 | 119 |
| 6 | 3300042635 | Ga0466702_199616 | Ga0466702_199616_1023_1382 | 119 |
| 7 | 3300042590 | Ga0466690_041361 | Ga0466690_041361_412_774 | 120 |
| 8 | 3300042591 | Ga0466692_047119 | Ga0466692_047119_12812_13174 | 120 |
| 9 | 3300042592 | Ga0466693_437327 | Ga0466693_437327_89915_90277 | 120 |
| 10 | 3300042593 | Ga0466691_020090 | Ga0466691_020090_405_767 | 120 |
| 11 | 3300042593 | Ga0466691_038666 | Ga0466691_038666_472_834 | 120 |
| 12 | 3300042616 | Ga0466715_172769 | Ga0466715_172769_514_876 | 120 |
| 13 | 3300042617 | Ga0466718_042044 | Ga0466718_042044_1549_1911 | 120 |
| 14 | 3300042617 | Ga0466718_064120 | Ga0466718_064120_3863_4225 | 120 |
| 15 | 3300042618 | Ga0466723_269196 | Ga0466723_269196_2626_2988 | 120 |
| 16 | 3300042620 | Ga0466728_109387 | Ga0466728_109387_13644_14006 | 120 |
| 17 | 3300042620 | Ga0466728_259324 | Ga0466728_259324_19_381 | 120 |
| 18 | 3300042656 | Ga0466732_214374 | Ga0466732_214374_2126_2488 | 120 |
| 19 | iso_pr_bacteria | 2819992462 | 2819994374 | 120 |
| 20 | iso_pr_bacteria | 2820020240 | 2820021422 | 120 |
| 21 | 3300000089 | AustNasuHG_c1002498 | AustNasuHG_10024985 | 121 |
| 22 | 3300001880 | FAAS_10426480 | FAAS_104264801 | 121 |
| 23 | 3300005200 | Ga0072940_1032163 | Ga0072940_10321634 | 121 |
| 24 | 3300010167 | Ga0123353_10389349 | Ga0123353_103893492 | 121 |
| 25 | 3300042593 | Ga0466691_120976 | Ga0466691_120976_1592_1957 | 121 |
| 26 | 3300042596 | Ga0466696_221432 | Ga0466696_221432_2583_2948 | 121 |
| 27 | 3300042596 | Ga0466696_299402 | Ga0466696_299402_11511_11876 | 121 |
| 28 | 3300042612 | Ga0466705_195441 | Ga0466705_195441_111_476 | 121 |
| 29 | 3300042612 | Ga0466705_203653 | Ga0466705_203653_3331_3696 | 121 |
| 30 | 3300042618 | Ga0466723_045242 | Ga0466723_045242_636_1001 | 121 |
| 31 | 3300042618 | Ga0466723_256619 | Ga0466723_256619_4298_4663 | 121 |
| 32 | 3300042619 | Ga0466726_229605 | Ga0466726_229605_480_845 | 121 |
| 33 | 3300042620 | Ga0466728_317877 | Ga0466728_317877_659_1024 | 121 |
| 34 | 3300042652 | Ga0466708_385450 | Ga0466708_385450_795_1160 | 121 |
| 35 | 3300042656 | Ga0466732_120343 | Ga0466732_120343_3021_3386 | 121 |
| 36 | 3300002504 | JGI24705J35276_11308826 | JGI24705J35276_113088261 | 122 |
| 37 | 3300042590 | Ga0466690_157214 | Ga0466690_157214_1489_1857 | 122 |
| 38 | 3300042596 | Ga0466696_137087 | Ga0466696_137087_12256_12624 | 122 |
| 39 | 3300042605 | Ga0466716_316398 | Ga0466716_316398_1093_1461 | 122 |
| 40 | 3300042606 | Ga0466719_312121 | Ga0466719_312121_10266_10634 | 122 |
| 41 | 3300042612 | Ga0466705_016622 | Ga0466705_016622_171_539 | 122 |
| 42 | 3300042612 | Ga0466705_167082 | Ga0466705_167082_2575_2943 | 122 |
| 43 | 3300042618 | Ga0466723_015754 | Ga0466723_015754_5263_5631 | 122 |
| 44 | 3300042618 | Ga0466723_211368 | Ga0466723_211368_1641_2009 | 122 |
| 45 | 3300042619 | Ga0466726_049062 | Ga0466726_049062_16_384 | 122 |
| 46 | 3300042619 | Ga0466726_252948 | Ga0466726_252948_548_916 | 122 |
| 47 | 3300042620 | Ga0466728_049460 | Ga0466728_049460_472_840 | 122 |
| 48 | 3300042620 | Ga0466728_157394 | Ga0466728_157394_431_799 | 122 |
| 49 | 3300042620 | Ga0466728_312247 | Ga0466728_312247_442_810 | 122 |
| 50 | 3300042624 | Ga0466735_025271 | Ga0466735_025271_10954_11322 | 122 |
| 51 | 3300042636 | Ga0466703_302348 | Ga0466703_302348_5014_5382 | 122 |
| 52 | 3300042643 | Ga0466704_131311 | Ga0466704_131311_3911_4279 | 122 |
| 53 | 3300042643 | Ga0466704_137917 | Ga0466704_137917_2133_2501 | 122 |
| 54 | 3300042643 | Ga0466704_478969 | Ga0466704_478969_309_677 | 122 |
| 55 | 3300042643 | Ga0466704_507153 | Ga0466704_507153_3252_3620 | 122 |
| 56 | 3300042643 | Ga0466704_594297 | Ga0466704_594297_3309_3677 | 122 |
| 57 | 3300042652 | Ga0466708_156340 | Ga0466708_156340_8314_8682 | 122 |
| 58 | 3300042652 | Ga0466708_428172 | Ga0466708_428172_3540_3908 | 122 |
| 59 | 3300005071 | Ga0068302_10060245 | Ga0068302_100602452 | 123 |
| 60 | 3300042590 | Ga0466690_387033 | Ga0466690_387033_1326_1697 | 123 |
| 61 | 3300042593 | Ga0466691_103781 | Ga0466691_103781_17786_18157 | 123 |
| 62 | 3300042596 | Ga0466696_393325 | Ga0466696_393325_3568_3939 | 123 |
| 63 | 3300042606 | Ga0466719_337717 | Ga0466719_337717_3779_4150 | 123 |
| 64 | 3300042615 | Ga0466711_318079 | Ga0466711_318079_507_878 | 123 |
| 65 | 3300042615 | Ga0466711_411482 | Ga0466711_411482_64_435 | 123 |
| 66 | 3300042616 | Ga0466715_021799 | Ga0466715_021799_20263_20634 | 123 |
| 67 | 3300042618 | Ga0466723_245776 | Ga0466723_245776_136_507 | 123 |
| 68 | 3300042619 | Ga0466726_487118 | Ga0466726_487118_445_816 | 123 |
| 69 | 3300042635 | Ga0466702_084450 | Ga0466702_084450_776_1147 | 123 |
| 70 | 3300042635 | Ga0466702_377275 | Ga0466702_377275_12_383 | 123 |
| 71 | 3300042636 | Ga0466703_204521 | Ga0466703_204521_2680_3051 | 123 |
| 72 | 3300042643 | Ga0466704_145851 | Ga0466704_145851_3992_4363 | 123 |
| 73 | 3300042652 | Ga0466708_434581 | Ga0466708_434581_1293_1664 | 123 |
| 74 | iso_pr_bacteria | 650716102 | 650882359 | 123 |
| 75 | 3300005200 | Ga0072940_1197303 | Ga0072940_11973032 | 124 |
| 76 | 3300010049 | Ga0123356_10125807 | Ga0123356_101258072 | 124 |
| 77 | 3300010167 | Ga0123353_10587954 | Ga0123353_105879543 | 124 |
| 78 | 3300024493 | Ga0264413_104764 | Ga0264413_1047648 | 124 |
| 79 | 3300042596 | Ga0466696_172696 | Ga0466696_172696_542_916 | 124 |
| 80 | 3300042619 | Ga0466726_147521 | Ga0466726_147521_894_1268 | 124 |
| 81 | 3300042606 | Ga0466719_034491 | Ga0466719_034491_16960_17337 | 125 |
| 82 | 3300042612 | Ga0466705_057360 | Ga0466705_057360_812_1189 | 125 |
| 83 | 3300042619 | Ga0466726_152788 | Ga0466726_152788_210_587 | 125 |
| 84 | 3300042619 | Ga0466726_287770 | Ga0466726_287770_1636_2013 | 125 |
| 85 | 3300042624 | Ga0466735_152309 | Ga0466735_152309_718_1095 | 125 |
| 86 | 3300042643 | Ga0466704_290914 | Ga0466704_290914_2913_3290 | 125 |
| 87 | 3300042655 | Ga0466727_234543 | Ga0466727_234543_3978_4355 | 125 |
| 88 | 3300005201 | Ga0072941_1074982 | Ga0072941_10749824 | 126 |
| 89 | 3300042601 | Ga0466707_357489 | Ga0466707_357489_583_963 | 126 |
| 90 | 3300042636 | Ga0466703_144938 | Ga0466703_144938_902_1282 | 126 |
| 91 | 3300042606 | Ga0466719_370614 | Ga0466719_370614_1609_1992 | 127 |
| 92 | 3300002449 | JGI24698J34947_10120149 | JGI24698J34947_101201492 | 128 |
| 93 | 3300042615 | Ga0466711_383865 | Ga0466711_383865_32572_32958 | 128 |
| 94 | 3300042655 | Ga0466727_206118 | Ga0466727_206118_659_1045 | 128 |
| 95 | 3300042593 | Ga0466691_196349 | Ga0466691_196349_25159_25548 | 129 |
| 96 | 3300042612 | Ga0466705_364966 | Ga0466705_364966_1231_1620 | 129 |
| 97 | 3300042624 | Ga0466735_148895 | Ga0466735_148895_473_865 | 130 |
| 98 | 3300042621 | Ga0466729_117292 | Ga0466729_117292_1109_1507 | 132 |
| 99 | 3300005071 | Ga0068302_10045198 | Ga0068302_100451981 | 133 |
| 100 | 3300042615 | Ga0466711_148480 | Ga0466711_148480_3110_3517 | 135 |
| 101 | 3300042621 | Ga0466729_208508 | Ga0466729_208508_589_996 | 135 |
| 102 | iso_pr_bacteria | 2781125636 | 2781279590 | 136 |
| 103 | iso_pr_bacteria | 2781125646 | 2781301047 | 136 |
| 104 | 3300002450 | JGI24695J34938_10000135 | JGI24695J34938_100001357 | 137 |
| 105 | 3300042652 | Ga0466708_016703 | Ga0466708_016703_788_1201 | 137 |
| 106 | 3300010167 | Ga0123353_10190003 | Ga0123353_101900034 | 139 |
| 107 | 3300042615 | Ga0466711_378858 | Ga0466711_378858_1369_1809 | 146 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07736 | CM_1 | Chorismate mutase type I | 7 | 117 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.