Protein Family IF04826

Metagenome Isolate
162 Members
68 Samples
152 Scaffolds
315.14 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_016488|Ga0466691_016488_4799_5914
Length
350 aa
Sequence
MKVRRRRKHKECIHLFQVIYYASLYAPVIFFNCLFFPVAASNFVDYVRIYCRSGNGGAGAMHLHREKFVDKGGPDHVILRGDSQHWTLIHLKYRKHIHAEDGGKGGSALSTGADGADTVLDVPLGTIARNAETGEMLFEVTAHGEKKTLVKGGRGGMGNAFFKSATNQTPRYAQPGEPCREGWFVLELKILADVGLVGLPNAGKSTLLSVVSAAKPKIADYPFTTLEPNLGIVKYRDYKSFVMADIPGIIAGASEGKGLGLRFLRHIERNAVLLFLVPADSPDVCAEYRVLLRELQRYNPEMMDKKRLLAVSKCTLPKDVPHLFFSSLTQEGVAALKDLLWKTLNEKENS

πŸ“Š Sample Types

Isolate 6.2%
Metagenome 93.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 30.5%
Kalotermitidae 23.7%
Unclassified 6.8%
Termopsidae 6.8%
Formicidae 6.8%
Rhinotermitidae 5.1%
Drosophilidae 5.1%
Armadillidiidae 5.1%
Passalidae 3.4%
Culicidae 3.4%
Hydrophilidae 1.7%
Bombycidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
10 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
11 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
12 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
13 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
14 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2896330536 Sphingobacterium sp. xlx-96 Isolate
27 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
28 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
29 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
30 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
31 2896321640 Sphingobacterium sp. xlx-130 Isolate
32 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
33 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
34 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
35 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2896350215 Sphingobacterium sp. xlx-183 Isolate
40 2998907766 Penaeicola halotolerans LMIT005 Isolate
41 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
42 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
43 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
44 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
50 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
51 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
52 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
53 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
54 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
55 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
56 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
57 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
58 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
59 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
60 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
61 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
62 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
63 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
64 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
65 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
66 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
67 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
68 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10003260 3300010167 Bacteria 20476
2 Ga0123354_10082982 3300010882 Bacteria 4514
3 Ga0123354_10269183 3300010882 Bacteria 1681
4 Ga0160465_100011 3300012803 Bacteria 346564
5 Ga0466690_067878 3300042590 Bacteria 5368
6 Ga0466690_365297 3300042590 Bacteria 13158
7 Ga0466701_010527 3300042598 Bacteria 1888
8 Ga0466723_054878 3300042618 Bacteria 53248
9 Ga0466723_141613 3300042618 Bacteria 10974
10 Ga0466728_008202 3300042620 Bacteria 7566
11 2227330772 2225789004 Bacteria 28934
12 Ga0466735_009858 3300042624 Bacteria 3556
13 Ga0466703_159189 3300042636 Unclassified 1851
14 Ga0466724_23132 3300042649 Unclassified 3154
15 Ga0466724_65356 3300042649 Bacteria 5669
16 Ga0466708_130740 3300042652 Bacteria 21643
17 Ga0466708_238469 3300042652 Bacteria 6290
18 Ga0123356_10000726 3300010049 Bacteria 36353
19 Ga0123353_10004501 3300010167 Bacteria 17952
20 Ga0123353_10636805 3300010167 Bacteria 1513
21 Ga0123354_10046224 3300010882 Bacteria 6654
22 Ga0160470_100525 3300012813 Bacteria 15116
23 Ga0160455_100258 3300012837 Bacteria 39853
24 Ga0160457_1003138 3300012858 Bacteria 3002
25 Ga0466690_421855 3300042590 Bacteria 12532
26 Ga0466696_075284 3300042596 Bacteria 3481
27 Ga0466701_036354 3300042598 Bacteria 4863
28 Ga0466701_072449 3300042598 Bacteria 2203
29 Ga0466716_178418 3300042605 Bacteria 12563
30 Ga0466719_265093 3300042606 Bacteria 4600
31 Ga0466712_118189 3300042614 Bacteria 22024
32 Ga0466728_102471 3300042620 Bacteria 3623
33 Ga0466728_132211 3300042620 Bacteria 29619
34 Ga0068302_10231922 3300005071 Bacteria 2185
35 Ga0103268_1000138 3300007192 Bacteria 24170
36 Ga0466734_013372 3300042623 Bacteria 1080
37 Ga0466703_281572 3300042636 Bacteria 12329
38 Ga0466708_192538 3300042652 Bacteria 3408
39 Ga0466690_341863 3300042590 Bacteria 4615
40 Ga0466699_310702 3300042597 Bacteria 5785
41 Ga0466719_391091 3300042606 Bacteria 3310
42 Ga0466719_513069 3300042606 Bacteria 1143
43 Ga0466721_069278 3300042608 Bacteria 8090
44 Ga0466723_219163 3300042618 Bacteria 12394
45 Ga0466726_145590 3300042619 Bacteria 9288
46 Ga0466728_002442 3300042620 Bacteria 4274
47 Ga0466729_038630 3300042621 Bacteria 5286
48 Ga0102735_1000718 3300007080 Bacteria 7345
49 Ga0466735_050828 3300042624 Bacteria 2913
50 Ga0466704_351491 3300042643 Bacteria 49257
51 Ga0466704_415043 3300042643 Bacteria 1325
52 Ga0466709_162194 3300042648 Bacteria 7034
53 Ga0466709_287029 3300042648 Bacteria 41744
54 Ga0466708_409151 3300042652 Unclassified 4981
55 Ga0123356_10316504 3300010049 Bacteria 1672
56 Ga0123354_10048332 3300010882 Bacteria 6471
57 Ga0123354_10106331 3300010882 Bacteria 3746
58 Ga0466692_168883 3300042591 Bacteria 9822
59 Ga0466691_016488 3300042593 Bacteria 10071
60 Ga0466696_244978 3300042596 Bacteria 67990
61 Ga0466699_267798 3300042597 Unclassified 1485
62 Ga0466700_188753 3300042600 Bacteria 2479
63 Ga0466707_307638 3300042601 Bacteria 1108
64 Ga0466716_072533 3300042605 Bacteria 7703
65 Ga0466722_104502 3300042609 Bacteria 8364
66 Ga0466722_120746 3300042609 Bacteria 7217
67 Ga0466722_155124 3300042609 Bacteria 4964
68 Ga0466722_197152 3300042609 Bacteria 14286
69 Ga0466698_094137 3300042610 Bacteria 2368
70 Ga0466711_226790 3300042615 Bacteria 8257
71 Ga0466718_038924 3300042617 Bacteria 3787
72 Ga0466723_005119 3300042618 Bacteria 4041
73 Ga0466723_251372 3300042618 Bacteria 8326
74 Ga0466726_142050 3300042619 Bacteria 3097
75 Ga0466728_180096 3300042620 Bacteria 1190
76 Ga0104048_1001865 3300007143 Unclassified 7309
77 Ga0466709_204440 3300042648 Bacteria 87623
78 Ga0466727_040552 3300042655 Bacteria 9696
79 Ga0123356_10043982 3300010049 Bacteria 4158
80 Ga0123353_10001584 3300010167 Bacteria 27977
81 Ga0123353_10045480 3300010167 Bacteria 6966
82 Ga0123353_10206183 3300010167 Unclassified 3088
83 Ga0123353_10350965 3300010167 Bacteria 2223
84 Ga0160431_101395 3300012828 Unclassified 7008
85 Ga0466690_160122 3300042590 Bacteria 11975
86 Ga0466696_086263 3300042596 Bacteria 12874
87 Ga0466696_481040 3300042596 Bacteria 2886
88 Ga0466716_297779 3300042605 Bacteria 3575
89 Ga0466722_059928 3300042609 Bacteria 3406
90 Ga0466711_177939 3300042615 Bacteria 15871
91 Ga0466723_004942 3300042618 Bacteria 30582
92 Ga0466723_210506 3300042618 Bacteria 54048
93 Ga0466726_457944 3300042619 Unclassified 1204
94 JGI24702J35022_10000206 3300002462 Bacteria 32370
95 CVPL010W_10002402 3300002931 Bacteria 21983
96 Ga0072941_1077263 3300005201 Bacteria 3852
97 Ga0103267_1000036 3300007190 Bacteria 58694
98 Ga0466697_057091 3300042611 Bacteria 8269
99 Ga0466705_134816 3300042612 Bacteria 9131
100 Ga0466734_039355 3300042623 Bacteria 1409
101 Ga0466703_267412 3300042636 Bacteria 5394
102 Ga0466724_08055 3300042649 Unclassified 2816
103 Ga0466708_039878 3300042652 Bacteria 12578
104 Ga0466727_011196 3300042655 Bacteria 9723
105 Ga0160456_100088 3300012820 Bacteria 116871
106 Ga0466690_042308 3300042590 Bacteria 10596
107 Ga0466692_176604 3300042591 Bacteria 3992
108 Ga0466691_011801 3300042593 Bacteria 8506
109 Ga0466701_072239 3300042598 Bacteria 2364
110 Ga0466719_163176 3300042606 Unclassified 10940
111 Ga0466711_218446 3300042615 Bacteria 9822
112 Ga0466718_154896 3300042617 Bacteria 2070
113 Ga0466723_071771 3300042618 Bacteria 6044
114 Ga0466726_317131 3300042619 Bacteria 5773
115 Ga0466728_111518 3300042620 Bacteria 9204
116 IMNBL1DRAFT_c0000172 3300000062 Bacteria 58110
117 IMNBL1DRAFT_c0018514 3300000062 Bacteria 2892
118 Ga0072940_1292414 3300005200 Bacteria 1226
119 Ga0104019_1002140 3300007150 Bacteria 4404
120 Ga0103267_1000058 3300007190 Bacteria 85745
121 Ga0466697_104570 3300042611 Bacteria 1352
122 Ga0466727_025948 3300042655 Bacteria 9440
123 Ga0160447_100023 3300012849 Bacteria 248054
124 Ga0466696_013496 3300042596 Bacteria 2306
125 Ga0466696_025664 3300042596 Bacteria 5987
126 Ga0466699_059379 3300042597 Bacteria 3659
127 Ga0466719_352545 3300042606 Bacteria 10649
128 Ga0466733_054890 3300042659 Bacteria 1976
129 Ga0466733_104875 3300042659 Bacteria 10917
130 Ga0466715_188508 3300042616 Bacteria 13972
131 Ga0466723_128705 3300042618 Bacteria 25504
132 Ga0466729_162344 3300042621 Bacteria 1459
133 IMNBL1DRAFT_c0013210 3300000062 Bacteria 3722
134 JGI24705J35276_12233323 3300002504 Bacteria 4776
135 Ga0104050_1002271 3300007153 Bacteria 7756
136 Ga0466697_057500 3300042611 Bacteria 2211
137 Ga0466735_037885 3300042624 Bacteria 6680
138 Ga0466703_204210 3300042636 Unclassified 5682
139 Ga0466703_227030 3300042636 Bacteria 1486
140 Ga0466724_50758 3300042649 Unclassified 1010
141 Ga0160453_100001 3300012814 Bacteria 1272344
142 Ga0466690_057250 3300042590 Bacteria 4769
143 Ga0466696_069308 3300042596 Bacteria 12314
144 Ga0466716_281639 3300042605 Bacteria 4912
145 Ga0466732_391036 3300042656 Bacteria 4178
146 Ga0466711_088394 3300042615 Bacteria 6324
147 Ga0466711_171503 3300042615 Bacteria 16708
148 Ga0466715_040991 3300042616 Bacteria 6773
149 Ga0466723_083200 3300042618 Bacteria 3677
150 Ga0068302_10146618 3300005071 Bacteria 1684
151 Ga0072941_1062774 3300005201 Bacteria 6242
152 Ga0104050_1004400 3300007153 Bacteria 25578

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_267798 Ga0466699_267798_638_1414 258
2 3300042617 Ga0466718_154896 Ga0466718_154896_11_835 274
3 3300042606 Ga0466719_163176 Ga0466719_163176_6459_7358 280
4 3300042649 Ga0466724_50758 Ga0466724_50758_22_942 280
5 3300042618 Ga0466723_128705 Ga0466723_128705_7872_8801 286
6 3300042590 Ga0466690_067878 Ga0466690_067878_1362_2261 291
7 3300042590 Ga0466690_365297 Ga0466690_365297_3735_4634 291
8 3300042596 Ga0466696_075284 Ga0466696_075284_390_1289 291
9 3300042606 Ga0466719_391091 Ga0466719_391091_1065_1964 291
10 3300042611 Ga0466697_104570 Ga0466697_104570_30_929 291
11 3300042612 Ga0466705_134816 Ga0466705_134816_4296_5195 291
12 3300042618 Ga0466723_083200 Ga0466723_083200_2359_3258 291
13 3300042618 Ga0466723_141613 Ga0466723_141613_9112_10011 291
14 3300042618 Ga0466723_219163 Ga0466723_219163_7196_8095 291
15 3300042620 Ga0466728_002442 Ga0466728_002442_568_1467 291
16 3300042620 Ga0466728_008202 Ga0466728_008202_531_1430 291
17 3300042620 Ga0466728_180096 Ga0466728_180096_165_1064 291
18 3300042648 Ga0466709_162194 Ga0466709_162194_4971_5870 291
19 3300042652 Ga0466708_039878 Ga0466708_039878_9634_10533 291
20 3300042652 Ga0466708_192538 Ga0466708_192538_1030_1929 291
21 3300042652 Ga0466708_238469 Ga0466708_238469_3291_4190 291
22 3300042597 Ga0466699_310702 Ga0466699_310702_4511_5455 297
23 3300042596 Ga0466696_013496 Ga0466696_013496_472_1395 299
24 3300042606 Ga0466719_265093 Ga0466719_265093_3145_4068 299
25 3300042617 Ga0466718_038924 Ga0466718_038924_1425_2393 299
26 3300042618 Ga0466723_054878 Ga0466723_054878_9620_10540 299
27 3300042659 Ga0466733_054890 Ga0466733_054890_868_1791 299
28 3300042590 Ga0466690_421855 Ga0466690_421855_11292_12215 300
29 3300042643 Ga0466704_351491 Ga0466704_351491_4706_5629 300
30 3300042609 Ga0466722_059928 Ga0466722_059928_989_1918 301
31 3300042609 Ga0466722_120746 Ga0466722_120746_5474_6403 301
32 3300042615 Ga0466711_226790 Ga0466711_226790_1661_2590 301
33 3300042652 Ga0466708_409151 Ga0466708_409151_1936_2865 301
34 3300010167 Ga0123353_10001584 Ga0123353_1000158413 302
35 3300012820 Ga0160456_100088 Ga0160456_10008836 302
36 3300042590 Ga0466690_057250 Ga0466690_057250_1079_2014 303
37 3300042597 Ga0466699_059379 Ga0466699_059379_461_1393 303
38 3300042620 Ga0466728_102471 Ga0466728_102471_1742_2677 303
39 3300042636 Ga0466703_204210 Ga0466703_204210_3932_4921 305
40 3300042649 Ga0466724_23132 Ga0466724_23132_680_1678 305
41 3300042652 Ga0466708_130740 Ga0466708_130740_1997_2983 305
42 3300000062 IMNBL1DRAFT_c0018514 IMNBL1DRAFT_00185142 306
43 3300005201 Ga0072941_1062774 Ga0072941_10627744 306
44 3300042615 Ga0466711_171503 Ga0466711_171503_746_1738 306
45 3300042624 Ga0466735_037885 Ga0466735_037885_1979_2968 306
46 3300042590 Ga0466690_160122 Ga0466690_160122_5403_6326 307
47 3300042598 Ga0466701_036354 Ga0466701_036354_2544_3542 307
48 3300042598 Ga0466701_072239 Ga0466701_072239_1119_2117 307
49 3300042649 Ga0466724_08055 Ga0466724_08055_679_1677 307
50 3300012814 Ga0160453_100001 Ga0160453_100001226 308
51 3300042593 Ga0466691_011801 Ga0466691_011801_4038_5036 308
52 3300007153 Ga0104050_1002271 Ga0104050_10022712 309
53 3300042636 Ga0466703_267412 Ga0466703_267412_2204_3202 309
54 3300007192 Ga0103268_1000138 Ga0103268_100013817 310
55 3300042605 Ga0466716_178418 Ga0466716_178418_1442_2431 310
56 3300042655 Ga0466727_025948 Ga0466727_025948_4773_5762 310
57 3300042614 Ga0466712_118189 Ga0466712_118189_12220_13221 311
58 3300012828 Ga0160431_101395 Ga0160431_1013953 313
59 3300042598 Ga0466701_010527 Ga0466701_010527_757_1746 315
60 3300042620 Ga0466728_111518 Ga0466728_111518_5108_6097 315
61 3300007143 Ga0104048_1001865 Ga0104048_10018652 316
62 3300007150 Ga0104019_1002140 Ga0104019_10021404 316
63 3300042615 Ga0466711_088394 Ga0466711_088394_3670_4671 317
64 3300042623 Ga0466734_013372 Ga0466734_013372_60_1052 317
65 3300042649 Ga0466724_65356 Ga0466724_65356_208_1206 317
66 3300010167 Ga0123353_10004501 Ga0123353_100045014 318
67 3300010882 Ga0123354_10046224 Ga0123354_100462249 318
68 3300042609 Ga0466722_155124 Ga0466722_155124_3060_4040 318
69 3300005200 Ga0072940_1292414 Ga0072940_12924141 319
70 3300012813 Ga0160470_100525 Ga0160470_1005256 319
71 3300042606 Ga0466719_352545 Ga0466719_352545_8676_9665 319
72 3300042618 Ga0466723_004942 Ga0466723_004942_11302_12291 319
73 3300042636 Ga0466703_159189 Ga0466703_159189_764_1753 319
74 3300042636 Ga0466703_227030 Ga0466703_227030_99_1088 319
75 3300042648 Ga0466709_204440 Ga0466709_204440_63869_64861 319
76 3300042590 Ga0466690_042308 Ga0466690_042308_900_1889 320
77 3300042596 Ga0466696_244978 Ga0466696_244978_39454_40440 320
78 3300042605 Ga0466716_072533 Ga0466716_072533_1148_2134 320
79 3300042590 Ga0466690_341863 Ga0466690_341863_1001_1990 321
80 3300042605 Ga0466716_297779 Ga0466716_297779_639_1628 321
81 3300042606 Ga0466719_513069 Ga0466719_513069_137_1126 321
82 3300042615 Ga0466711_218446 Ga0466711_218446_5487_6476 321
83 3300042616 Ga0466715_040991 Ga0466715_040991_2938_3927 321
84 3300042618 Ga0466723_210506 Ga0466723_210506_4759_5748 321
85 3300042618 Ga0466723_251372 Ga0466723_251372_5354_6343 321
86 3300042624 Ga0466735_009858 Ga0466735_009858_1565_2554 321
87 3300042643 Ga0466704_415043 Ga0466704_415043_62_1051 321
88 3300010049 Ga0123356_10043982 Ga0123356_100439823 322
89 3300010167 Ga0123353_10206183 Ga0123353_102061832 322
90 3300010167 Ga0123353_10636805 Ga0123353_106368052 322
91 3300042591 Ga0466692_176604 Ga0466692_176604_200_1192 322
92 3300042596 Ga0466696_086263 Ga0466696_086263_7523_8515 322
93 3300042596 Ga0466696_481040 Ga0466696_481040_541_1533 322
94 3300042605 Ga0466716_281639 Ga0466716_281639_1283_2275 322
95 3300042621 Ga0466729_162344 Ga0466729_162344_68_1060 322
96 3300042624 Ga0466735_050828 Ga0466735_050828_42_1034 322
97 3300042659 Ga0466733_104875 Ga0466733_104875_3128_4120 322
98 3300007153 Ga0104050_1004400 Ga0104050_10044008 323
99 3300010167 Ga0123353_10045480 Ga0123353_100454803 323
100 3300010167 Ga0123353_10350965 Ga0123353_103509653 323
101 3300010882 Ga0123354_10048332 Ga0123354_100483323 323
102 3300010882 Ga0123354_10082982 Ga0123354_100829822 323
103 3300010882 Ga0123354_10269183 Ga0123354_102691832 323
104 3300012803 Ga0160465_100011 Ga0160465_100011168 323
105 3300012849 Ga0160447_100023 Ga0160447_100023136 323
106 3300042615 Ga0466711_177939 Ga0466711_177939_2014_3009 323
107 3300042619 Ga0466726_142050 Ga0466726_142050_1496_2491 323
108 2225789004 2227330772 2227778273 324
109 3300000062 IMNBL1DRAFT_c0000172 IMNBL1DRAFT_000017255 324
110 3300000062 IMNBL1DRAFT_c0013210 IMNBL1DRAFT_00132103 324
111 3300005201 Ga0072941_1077263 Ga0072941_10772633 324
112 3300042591 Ga0466692_168883 Ga0466692_168883_4270_5268 324
113 3300042596 Ga0466696_069308 Ga0466696_069308_7726_8724 324
114 3300042608 Ga0466721_069278 Ga0466721_069278_7046_8044 324
115 3300042609 Ga0466722_104502 Ga0466722_104502_261_1259 324
116 3300042609 Ga0466722_197152 Ga0466722_197152_8572_9570 324
117 3300042610 Ga0466698_094137 Ga0466698_094137_798_1796 324
118 3300042611 Ga0466697_057091 Ga0466697_057091_5445_6443 324
119 3300042618 Ga0466723_005119 Ga0466723_005119_140_1138 324
120 3300042619 Ga0466726_145590 Ga0466726_145590_3093_4091 324
121 3300042619 Ga0466726_457944 Ga0466726_457944_39_1037 324
122 3300042620 Ga0466728_132211 Ga0466728_132211_22465_23463 324
123 3300042623 Ga0466734_039355 Ga0466734_039355_280_1278 324
124 3300042655 Ga0466727_011196 Ga0466727_011196_139_1137 324
125 3300042656 Ga0466732_391036 Ga0466732_391036_1858_2856 324
126 3300002462 JGI24702J35022_10000206 JGI24702J35022_1000020610 325
127 3300002504 JGI24705J35276_12233323 JGI24705J35276_122333236 325
128 3300005071 Ga0068302_10146618 Ga0068302_101466183 325
129 3300005071 Ga0068302_10231922 Ga0068302_102319222 325
130 3300010049 Ga0123356_10000726 Ga0123356_1000072628 325
131 3300010049 Ga0123356_10316504 Ga0123356_103165041 325
132 3300010167 Ga0123353_10003260 Ga0123353_100032606 325
133 3300042598 Ga0466701_072449 Ga0466701_072449_36_1037 325
134 3300042600 Ga0466700_188753 Ga0466700_188753_264_1265 325
135 3300042619 Ga0466726_317131 Ga0466726_317131_3596_4597 325
136 3300042621 Ga0466729_038630 Ga0466729_038630_3014_4015 325
137 3300042616 Ga0466715_188508 Ga0466715_188508_2343_3347 326
138 3300042648 Ga0466709_287029 Ga0466709_287029_34977_35981 326
139 3300007080 Ga0102735_1000718 Ga0102735_10007184 327
140 3300002931 CVPL010W_10002402 CVPL010W_100024025 328
141 3300007190 Ga0103267_1000036 Ga0103267_100003616 328
142 3300007190 Ga0103267_1000058 Ga0103267_100005810 328
143 3300010882 Ga0123354_10106331 Ga0123354_101063312 328
144 3300012837 Ga0160455_100258 Ga0160455_10025834 329
145 3300042618 Ga0466723_071771 Ga0466723_071771_4234_5247 329
146 iso_pr_bacteria 2718218155 2720328238 329
147 iso_pr_bacteria 2998907766 2998910530 330
148 3300042596 Ga0466696_025664 Ga0466696_025664_1864_2883 331
149 iso_pr_bacteria 2873776654 2873777639 331
150 3300012858 Ga0160457_1003138 Ga0160457_10031381 332
151 iso_pr_bacteria 2579779088 2582238228 332
152 iso_pr_bacteria 2820748953 2820749346 332
153 iso_pr_bacteria 2820772500 2820774062 332
154 iso_pr_bacteria 2820781750 2820781826 332
155 iso_pr_bacteria 2896321640 2896322882 333
156 iso_pr_bacteria 2896330536 2896331409 333
157 iso_pr_bacteria 2896350215 2896351430 333
158 3300042636 Ga0466703_281572 Ga0466703_281572_6171_7199 334
159 3300042601 Ga0466707_307638 Ga0466707_307638_17_1078 344
160 3300042655 Ga0466727_040552 Ga0466727_040552_8160_9221 345
161 3300042611 Ga0466697_057500 Ga0466697_057500_1123_2190 347
162 3300042593 Ga0466691_016488 Ga0466691_016488_4799_5914 350

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01018 GTP1_OBG GTP1/OBG 44 190 0.99
PF02421 FeoB_N Ferrous iron transport protein B 194 250 0.89
PF01926 MMR_HSR1 50S ribosome-binding GTPase 193 313 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02421 GO:0005525 GTP binding MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.53 0.63 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.