Protein Family IF04800

Metagenome Isolate
109 Members
40 Samples
105 Scaffolds
248 Avg Length

🧬 Representative Sequence

ID
3300042592|Ga0466693_343356|Ga0466693_343356_5155_6000
Length
281 aa
Sequence
LKVDFAVPELCLAWQIRLFPVSCKPMPRNITYTALTLRVKASGESNRETWFLTAEEGIVKATVFGGPKSRLRSRVAPFHEGTLWVYHDPVRDSRKVSDFDVRSYRQGIRELYERVMTADAVAQTILESSGGGGNWQTAARLAAGVLDGIAGADAALCTRLGVYFLWHWADILGIRPDLAACAACGNQTPRNEPLHFHAANQTLLCGDCSQGEDEYSLPTSLRQPIKVSPGARLWLHRIENLPPESLARFTLDNTSLEQAKTLSKAVLTRAFEKRLPTWDGI

📊 Sample Types

Isolate 3.7%
Metagenome 96.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.5%
Kalotermitidae 32.5%
Unclassified 17.5%
Rhinotermitidae 7.5%
Termopsidae 5.0%

🌳 Taxonomy

Archaea 0
Bacteria 102
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
9 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
18 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
19 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_050316 3300042612 Bacteria 19211
2 Ga0466709_013054 3300042648 Bacteria 3566
3 Ga0466712_117050 3300042614 Bacteria 4934
4 Ga0466711_081327 3300042615 Bacteria 5713
5 Ga0466718_137795 3300042617 Bacteria 1056
6 Ga0466726_179745 3300042619 Bacteria 2153
7 Ga0466707_392900 3300042601 Bacteria 1082
8 Ga0466713_084112 3300042602 Unclassified 1391
9 Ga0466720_104985 3300042607 Unclassified 2214
10 Ga0456237_0000603 3300041968 Bacteria 5494
11 Ga0456237_0013967 3300041968 Bacteria 1147
12 Ga0466690_269898 3300042590 Bacteria 1491
13 Ga0466694_071679 3300042594 Bacteria 3149
14 Ga0123353_11170811 3300010167 Bacteria 1012
15 Ga0068305_10027608 3300005083 Bacteria 9049
16 Ga0466705_038872 3300042612 Bacteria 13503
17 Ga0466709_003530 3300042648 Bacteria 4422
18 Ga0466712_242529 3300042614 Bacteria 8036
19 Ga0466715_010529 3300042616 Bacteria 11517
20 Ga0466715_297702 3300042616 Bacteria 7527
21 Ga0466690_240126 3300042590 Bacteria 1338
22 Ga0466694_047806 3300042594 Bacteria 11279
23 Ga0466694_101023 3300042594 Bacteria 13807
24 Ga0123353_10023541 3300010167 Bacteria 9328
25 JGI24698J34947_10018112 3300002449 Unclassified 3811
26 JGI24698J34947_10029199 3300002449 Bacteria 2914
27 Ga0466733_063080 3300042659 Bacteria 29367
28 Ga0466733_141420 3300042659 Bacteria 62681
29 Ga0466733_163811 3300042659 Unclassified 6581
30 Ga0466735_059358 3300042624 Bacteria 5334
31 Ga0466703_368445 3300042636 Bacteria 2113
32 Ga0466709_186972 3300042648 Bacteria 1997
33 Ga0466709_278568 3300042648 Bacteria 3047
34 Ga0466712_018665 3300042614 Bacteria 35330
35 Ga0466711_352525 3300042615 Bacteria 66792
36 Ga0466723_140965 3300042618 Bacteria 12276
37 Ga0466707_351764 3300042601 Bacteria 1891
38 Ga0466716_133126 3300042605 Bacteria 1923
39 Ga0466722_087782 3300042609 Bacteria 5653
40 Ga0466690_097456 3300042590 Bacteria 9815
41 JGI24698J34947_10006811 3300002449 Bacteria 6280
42 Ga0466705_128976 3300042612 Bacteria 3537
43 Ga0466704_093891 3300042643 Bacteria 45240
44 Ga0466704_288260 3300042643 Bacteria 16251
45 Ga0466712_054354 3300042614 Bacteria 3914
46 Ga0466712_130382 3300042614 Bacteria 1299
47 Ga0466712_192768 3300042614 Bacteria 48341
48 Ga0466719_053280 3300042606 Bacteria 1153
49 Ga0466719_394976 3300042606 Bacteria 13368
50 Ga0466692_182761 3300042591 Bacteria 12309
51 Ga0123355_10083444 3300009826 Bacteria 5094
52 JGI24702J35022_10269092 3300002462 Bacteria 997
53 Ga0466723_065737 3300042618 Bacteria 6964
54 Ga0466723_342585 3300042618 Bacteria 1428
55 Ga0466690_195028 3300042590 Bacteria 11044
56 Ga0123353_10045899 3300010167 Bacteria 6938
57 JGI24705J35276_12179194 3300002504 Bacteria 1353
58 Ga0466733_038014 3300042659 Bacteria 1268
59 Ga0466733_147535 3300042659 Bacteria 34154
60 Ga0466733_181670 3300042659 Bacteria 2553
61 Ga0466704_297018 3300042643 Bacteria 13882
62 Ga0466712_115137 3300042614 Bacteria 7486
63 Ga0466726_389729 3300042619 Bacteria 2575
64 Ga0466728_017645 3300042620 Unclassified 1156
65 Ga0466707_086383 3300042601 Bacteria 1551
66 Ga0466696_175819 3300042596 Bacteria 19045
67 Ga0123356_10152410 3300010049 Bacteria 2297
68 Ga0123353_10267676 3300010167 Bacteria 2635
69 JGI24698J34947_10005929 3300002449 Unclassified 6702
70 JGI24698J34947_10009765 3300002449 Bacteria 5261
71 Ga0123357_10001571 3300009784 Bacteria 24387
72 Ga0466705_263550 3300042612 Bacteria 16833
73 Ga0466711_171789 3300042615 Bacteria 6304
74 Ga0466715_414728 3300042616 Bacteria 1427
75 Ga0466718_010291 3300042617 Bacteria 1362
76 Ga0466718_127252 3300042617 Bacteria 1255
77 Ga0466723_074492 3300042618 Bacteria 27779
78 Ga0466728_115821 3300042620 Bacteria 5427
79 Ga0466707_116260 3300042601 Bacteria 1061
80 Ga0466707_406614 3300042601 Bacteria 1037
81 Ga0466716_146436 3300042605 Bacteria 9076
82 Ga0466691_097975 3300042593 Bacteria 9703
83 Ga0466694_176447 3300042594 Bacteria 2577
84 Ga0466694_328427 3300042594 Bacteria 2070
85 Ga0466696_392029 3300042596 Bacteria 16619
86 Ga0123353_10545691 3300010167 Bacteria 1674
87 Ga0123353_10592433 3300010167 Bacteria 1587
88 Ga0123353_11028598 3300010167 Bacteria 1103
89 Ga0123353_11167624 3300010167 Bacteria 1014
90 JGI24695J34938_10034974 3300002450 Bacteria 2301
91 Ga0466703_155902 3300042636 Bacteria 14184
92 Ga0466709_046358 3300042648 Bacteria 3203
93 Ga0466712_133895 3300042614 Bacteria 5203
94 Ga0466715_126305 3300042616 Bacteria 4696
95 Ga0466718_044499 3300042617 Bacteria 1768
96 Ga0466726_314320 3300042619 Bacteria 1499
97 Ga0466719_174880 3300042606 Bacteria 12435
98 Ga0466720_004264 3300042607 Bacteria 2625
99 Ga0466722_250320 3300042609 Bacteria 1740
100 Ga0466693_343356 3300042592 Bacteria 6809
101 Ga0466691_058054 3300042593 Bacteria 1822
102 Ga0466694_159200 3300042594 Unclassified 2242
103 Ga0466695_183037 3300042595 Bacteria 8571
104 Ga0123356_10957826 3300010049 Bacteria 1027
105 JGI24698J34947_10001714 3300002449 Bacteria 11675

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042648 Ga0466709_003530 Ga0466709_003530_2167_2799 210
2 3300042643 Ga0466704_093891 Ga0466704_093891_38440_39123 212
3 3300042590 Ga0466690_097456 Ga0466690_097456_6000_6683 213
4 3300010049 Ga0123356_10152410 Ga0123356_101524102 221
5 3300010167 Ga0123353_11028598 Ga0123353_110285982 226
6 3300002462 JGI24702J35022_10269092 JGI24702J35022_102690921 228
7 3300042624 Ga0466735_059358 Ga0466735_059358_3485_4237 228
8 3300041968 Ga0456237_0000603 Ga0456237_0000603_2235_2972 229
9 3300042618 Ga0466723_074492 Ga0466723_074492_7336_8067 229
10 3300042612 Ga0466705_038872 Ga0466705_038872_4388_5167 231
11 3300042594 Ga0466694_328427 Ga0466694_328427_913_1614 233
12 3300042615 Ga0466711_081327 Ga0466711_081327_3366_4118 233
13 3300042594 Ga0466694_176447 Ga0466694_176447_310_1071 235
14 3300042590 Ga0466690_240126 Ga0466690_240126_110_823 237
15 3300042618 Ga0466723_342585 Ga0466723_342585_557_1303 237
16 3300042618 Ga0466723_140965 Ga0466723_140965_6373_7113 238
17 3300042636 Ga0466703_368445 Ga0466703_368445_222_980 240
18 3300009784 Ga0123357_10001571 Ga0123357_1000157117 242
19 3300010167 Ga0123353_10023541 Ga0123353_100235419 243
20 3300042594 Ga0466694_071679 Ga0466694_071679_974_1726 243
21 3300042596 Ga0466696_175819 Ga0466696_175819_11631_12362 243
22 3300042648 Ga0466709_186972 Ga0466709_186972_680_1411 243
23 3300042594 Ga0466694_159200 Ga0466694_159200_1172_1921 244
24 3300042601 Ga0466707_406614 Ga0466707_406614_55_789 244
25 3300042601 Ga0466707_086383 Ga0466707_086383_470_1252 245
26 3300042601 Ga0466707_116260 Ga0466707_116260_95_832 245
27 3300042601 Ga0466707_351764 Ga0466707_351764_471_1208 245
28 3300042601 Ga0466707_392900 Ga0466707_392900_249_986 245
29 iso_pr_bacteria 650716099 650878305 245
30 3300010049 Ga0123356_10957826 Ga0123356_109578262 246
31 3300042590 Ga0466690_195028 Ga0466690_195028_5138_5878 246
32 3300042593 Ga0466691_097975 Ga0466691_097975_4859_5599 246
33 3300042596 Ga0466696_392029 Ga0466696_392029_4922_5662 246
34 3300042606 Ga0466719_053280 Ga0466719_053280_369_1109 246
35 3300042636 Ga0466703_155902 Ga0466703_155902_3896_4636 246
36 3300041968 Ga0456237_0013967 Ga0456237_0013967_44_787 247
37 3300042591 Ga0466692_182761 Ga0466692_182761_6317_7060 247
38 3300042593 Ga0466691_058054 Ga0466691_058054_496_1239 247
39 3300042605 Ga0466716_146436 Ga0466716_146436_4563_5306 247
40 3300042609 Ga0466722_087782 Ga0466722_087782_333_1106 247
41 3300042612 Ga0466705_050316 Ga0466705_050316_9096_9839 247
42 3300042616 Ga0466715_297702 Ga0466715_297702_6375_7118 247
43 3300042616 Ga0466715_414728 Ga0466715_414728_150_893 247
44 3300042617 Ga0466718_010291 Ga0466718_010291_261_1004 247
45 3300042617 Ga0466718_044499 Ga0466718_044499_471_1214 247
46 3300042617 Ga0466718_127252 Ga0466718_127252_167_910 247
47 3300042620 Ga0466728_017645 Ga0466728_017645_313_1056 247
48 3300042643 Ga0466704_288260 Ga0466704_288260_6661_7404 247
49 3300042590 Ga0466690_269898 Ga0466690_269898_408_1154 248
50 3300042594 Ga0466694_101023 Ga0466694_101023_1694_2440 248
51 3300042612 Ga0466705_128976 Ga0466705_128976_742_1488 248
52 3300042612 Ga0466705_263550 Ga0466705_263550_11759_12505 248
53 3300042616 Ga0466715_126305 Ga0466715_126305_784_1530 248
54 3300042618 Ga0466723_065737 Ga0466723_065737_3467_4213 248
55 3300042643 Ga0466704_297018 Ga0466704_297018_1827_2573 248
56 3300042648 Ga0466709_046358 Ga0466709_046358_1549_2295 248
57 3300002449 JGI24698J34947_10009765 JGI24698J34947_100097655 249
58 3300010167 Ga0123353_10545691 Ga0123353_105456912 249
59 3300042594 Ga0466694_047806 Ga0466694_047806_6094_6843 249
60 3300002450 JGI24695J34938_10034974 JGI24695J34938_100349742 250
61 3300042607 Ga0466720_104985 Ga0466720_104985_268_1020 250
62 3300042648 Ga0466709_278568 Ga0466709_278568_1961_2713 250
63 3300042609 Ga0466722_250320 Ga0466722_250320_612_1367 251
64 3300042619 Ga0466726_314320 Ga0466726_314320_490_1245 251
65 3300010167 Ga0123353_10045899 Ga0123353_100458993 252
66 3300010167 Ga0123353_11170811 Ga0123353_111708111 252
67 3300042595 Ga0466695_183037 Ga0466695_183037_4293_5078 252
68 3300042605 Ga0466716_133126 Ga0466716_133126_649_1407 252
69 3300042607 Ga0466720_004264 Ga0466720_004264_559_1317 252
70 3300042614 Ga0466712_130382 Ga0466712_130382_497_1255 252
71 3300042615 Ga0466711_171789 Ga0466711_171789_4340_5098 252
72 3300042616 Ga0466715_010529 Ga0466715_010529_9133_9891 252
73 3300042617 Ga0466718_137795 Ga0466718_137795_95_853 252
74 3300042620 Ga0466728_115821 Ga0466728_115821_1386_2144 252
75 3300042659 Ga0466733_147535 Ga0466733_147535_28080_28838 252
76 3300042659 Ga0466733_181670 Ga0466733_181670_964_1722 252
77 3300002449 JGI24698J34947_10006811 JGI24698J34947_100068115 253
78 3300009826 Ga0123355_10083444 Ga0123355_100834446 253
79 3300010167 Ga0123353_10592433 Ga0123353_105924332 253
80 3300042614 Ga0466712_018665 Ga0466712_018665_13293_14054 253
81 3300042614 Ga0466712_192768 Ga0466712_192768_44526_45287 253
82 3300042619 Ga0466726_179745 Ga0466726_179745_600_1361 253
83 3300042659 Ga0466733_038014 Ga0466733_038014_44_805 253
84 3300042659 Ga0466733_063080 Ga0466733_063080_17891_18652 253
85 iso_pr_bacteria 2781125666 2781344946 253
86 3300002504 JGI24705J35276_12179194 JGI24705J35276_121791941 254
87 3300042614 Ga0466712_115137 Ga0466712_115137_454_1218 254
88 3300042614 Ga0466712_133895 Ga0466712_133895_3571_4335 254
89 3300042659 Ga0466733_141420 Ga0466733_141420_23696_24460 254
90 3300042659 Ga0466733_163811 Ga0466733_163811_3660_4424 254
91 iso_pr_bacteria 2781125655 2781319561 254
92 3300002449 JGI24698J34947_10005929 JGI24698J34947_100059292 255
93 3300002449 JGI24698J34947_10018112 JGI24698J34947_100181122 255
94 3300042606 Ga0466719_394976 Ga0466719_394976_6506_7348 255
95 3300042648 Ga0466709_013054 Ga0466709_013054_2092_2910 255
96 3300010167 Ga0123353_10267676 Ga0123353_102676762 256
97 3300002449 JGI24698J34947_10001714 JGI24698J34947_1000171415 257
98 3300042614 Ga0466712_242529 Ga0466712_242529_3962_4735 257
99 3300042619 Ga0466726_389729 Ga0466726_389729_475_1248 257
100 iso_pr_bacteria 2781125653 2781313685 259
101 3300042614 Ga0466712_054354 Ga0466712_054354_1056_1844 262
102 3300042602 Ga0466713_084112 Ga0466713_084112_104_901 265
103 3300042615 Ga0466711_352525 Ga0466711_352525_36320_37117 265
104 3300002449 JGI24698J34947_10029199 JGI24698J34947_100291993 266
105 3300005083 Ga0068305_10027608 Ga0068305_100276089 266
106 3300042614 Ga0466712_117050 Ga0466712_117050_2919_3719 266
107 3300042606 Ga0466719_174880 Ga0466719_174880_3142_3963 273
108 3300010167 Ga0123353_11167624 Ga0123353_111676242 280
109 3300042592 Ga0466693_343356 Ga0466693_343356_5155_6000 281

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF11967 RecO_N Recombination protein O N terminal 29 88 0.89
PF02565 RecO_C Recombination protein O C terminal 141 277 0.74

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.