Protein Family IF04791

Metagenome Isolate
142 Members
61 Samples
123 Scaffolds
366.56 Avg Length

🧬 Representative Sequence

ID
3300042592|Ga0466693_278666|Ga0466693_278666_56_1231
Length
391 aa
Sequence
MAGASPRRAKKGTPCFTIAIKKQIEVANMKYDYLIVGAGLFGTVFAHEAVRRGKTCLVADKREHIGGNVYTAEIGGIQVHKYGAHIFHTNDKEVWEYVNRFAEFNRFTNAPVANYLGEIFNLPFNMNTFYKLWGVSCPQEALRIIEGQRLKTAEPKNLEEQALSMVGRDIYEKLIKGYTQKQWGRECTELPAFIIKRLPLRFTFDNSYFNDCFQGIPIGGYTQIIEKMLTGCDVRLGTDYFSCRAELDGLAKKTVYTGMTDEYFGFRFGRLEYRSLRFENETLDRENFQGVAVVNYTDAATPYTRIIEHKHFEFGTQPQTVITREYPKEFTQGDEPYYPINDDFNNELYAKYRKLADAEKNVIFGGRLADYKYYDMWQVVRNALDAAVALI

📊 Sample Types

Isolate 13.4%
Metagenome 86.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.0%
Unclassified 21.7%
Kalotermitidae 21.7%
Blattidae 8.3%
Tenebrionidae 6.7%
Termopsidae 5.0%
Apidae 3.3%
Passalidae 3.3%
Vespidae 1.7%
Hodotermitidae 1.7%
Drosophilidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 140
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
2 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
13 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
22 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
23 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
24 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
25 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
26 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
27 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
36 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
37 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
38 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
41 2511231129 Vibrio sp. EJY3 Isolate Unclassified
42 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
43 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 8007237282 Enterococcus sp. DIV0212c Isolate
46 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
47 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
48 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
49 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
50 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
51 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
54 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
55 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
56 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
57 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
58 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
59 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
60 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
61 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0009 3300056790 Bacteria 1927879
2 Ga0466706_198830 3300042599 Bacteria 1430
3 Ga0466713_134616 3300042602 Bacteria 2878
4 Ga0466714_093078 3300042603 Bacteria 3694
5 Ga0466716_461272 3300042605 Bacteria 7210
6 Ga0466723_131965 3300042618 Bacteria 3406
7 Ga0466726_341155 3300042619 Bacteria 2438
8 Ga0123353_10495186 3300010167 Bacteria 1783
9 JGI24702J35022_10001584 3300002462 Bacteria 14114
10 JGI24702J35022_10147119 3300002462 Bacteria 1319
11 Ga0466705_310573 3300042612 Bacteria 8383
12 Ga0562379_0346 3300056790 Bacteria 111489
13 Ga0466706_185672 3300042599 Bacteria 9871
14 Ga0466714_060377 3300042603 Bacteria 3056
15 Ga0466714_060675 3300042603 Bacteria 1501
16 Ga0466714_075322 3300042603 Bacteria 12504
17 Ga0466717_028783 3300042604 Bacteria 3648
18 Ga0466715_279443 3300042616 Bacteria 33719
19 Ga0466723_036342 3300042618 Bacteria 2155
20 Ga0123356_10009427 3300010049 Bacteria 9634
21 Ga0123356_10141716 3300010049 Bacteria 2372
22 Ga0415639_003875 3300038395 Bacteria 31877
23 Ga0415639_019554 3300038395 Bacteria 12574
24 Ga0466691_148361 3300042593 Bacteria 7603
25 Ga0466703_000993 3300042636 Bacteria 1894
26 Ga0466703_172414 3300042636 Bacteria 2230
27 IMNBL1DRAFT_c0000002 3300000062 Bacteria 288751
28 Ga0466705_358599 3300042612 Bacteria 55295
29 Ga0562379_0329 3300056790 Unclassified 116324
30 Ga0562378_1823 3300056814 Unclassified 20863
31 Ga0466713_039773 3300042602 Bacteria 12310
32 Ga0466719_484742 3300042606 Bacteria 6099
33 Ga0466721_210055 3300042608 Bacteria 3719
34 Ga0466715_023530 3300042616 Bacteria 12613
35 Ga0466715_376398 3300042616 Bacteria 1225
36 Ga0466723_150183 3300042618 Bacteria 6384
37 Ga0466726_027420 3300042619 Bacteria 23733
38 Ga0123356_10205237 3300010049 Bacteria 2014
39 Ga0123356_10227989 3300010049 Bacteria 1925
40 Ga0123356_10286629 3300010049 Bacteria 1745
41 Ga0123353_10001649 3300010167 Bacteria 27459
42 Ga0123353_10260499 3300010167 Bacteria 2679
43 Ga0466693_278666 3300042592 Bacteria 3273
44 Ga0466691_046095 3300042593 Bacteria 4636
45 Ga0466696_010174 3300042596 Bacteria 34499
46 Ga0466708_211570 3300042652 Bacteria 26487
47 2227158569 2225789004 Bacteria 8420
48 JGI24695J34938_10003969 3300002450 Bacteria 9970
49 Ga0068305_10005230 3300005083 Bacteria 6754
50 Ga0466706_062227 3300042599 Bacteria 2959
51 Ga0466706_205550 3300042599 Bacteria 8901
52 Ga0466707_233067 3300042601 Bacteria 1556
53 Ga0466707_336274 3300042601 Bacteria 8742
54 Ga0466712_004801 3300042614 Bacteria 20548
55 Ga0466711_109385 3300042615 Bacteria 2873
56 Ga0466715_045335 3300042616 Bacteria 32249
57 Ga0466723_347886 3300042618 Bacteria 4748
58 Ga0466726_449069 3300042619 Bacteria 3135
59 Ga0123355_10089382 3300009826 Bacteria 4889
60 Ga0466691_148224 3300042593 Bacteria 9593
61 Ga0466691_220365 3300042593 Bacteria 11607
62 Ga0466703_425813 3300042636 Bacteria 5486
63 Ga0466704_069430 3300042643 Bacteria 4358
64 Ga0466708_417930 3300042652 Bacteria 20575
65 JGI24695J34938_10000715 3300002450 Bacteria 31289
66 JGI24702J35022_10031911 3300002462 Bacteria 2821
67 Ga0068305_10027785 3300005083 Bacteria 5325
68 Ga0074188_1000238 3300005318 Bacteria 16620
69 Ga0466707_394085 3300042601 Bacteria 3291
70 Ga0123356_10114857 3300010049 Bacteria 2608
71 Ga0123356_10139472 3300010049 Bacteria 2390
72 Ga0123356_10145035 3300010049 Bacteria 2348
73 Ga0123356_10207739 3300010049 Bacteria 2003
74 Ga0466703_001811 3300042636 Bacteria 3694
75 Ga0466703_177436 3300042636 Bacteria 6065
76 Ga0466708_229225 3300042652 Bacteria 6590
77 Ga0072940_1455191 3300005200 Bacteria 5863
78 Ga0466706_046636 3300042599 Bacteria 5178
79 Ga0466706_088277 3300042599 Bacteria 16625
80 Ga0466706_172146 3300042599 Bacteria 27803
81 Ga0466714_012619 3300042603 Bacteria 11318
82 Ga0466714_107226 3300042603 Bacteria 8008
83 Ga0466716_468189 3300042605 Bacteria 5809
84 Ga0123356_10067622 3300010049 Bacteria 3346
85 Ga0123356_10142904 3300010049 Bacteria 2363
86 Ga0123353_10473645 3300010167 Bacteria 1835
87 Ga0415639_005382 3300038395 Bacteria 48683
88 Ga0415639_257920 3300038395 Bacteria 1939
89 Ga0466690_034706 3300042590 Bacteria 31208
90 Ga0466704_161605 3300042643 Bacteria 72612
91 Ga0072940_1396685 3300005200 Bacteria 1408
92 Ga0562379_0011 3300056790 Bacteria 1623141
93 Ga0562375_0012 3300056856 Bacteria 1240899
94 Ga0466701_094818 3300042598 Bacteria 4949
95 Ga0466706_052481 3300042599 Bacteria 20425
96 Ga0466707_044763 3300042601 Bacteria 2374
97 Ga0466714_043750 3300042603 Bacteria 4923
98 Ga0466705_518747 3300042612 Bacteria 9648
99 Ga0466711_286486 3300042615 Bacteria 8162
100 Ga0466728_192504 3300042620 Bacteria 13798
101 Ga0123357_10267663 3300009784 Bacteria 1793
102 Ga0123353_10373983 3300010167 Bacteria 2135
103 Ga0123353_10524018 3300010167 Bacteria 1719
104 Ga0466708_091330 3300042652 Bacteria 7322
105 Ga0466708_321892 3300042652 Bacteria 7928
106 Ga0466727_215100 3300042655 Bacteria 4081
107 JGI24695J34938_10000874 3300002450 Bacteria 27863
108 Ga0562379_0005 3300056790 Bacteria 2649770
109 Ga0562377_0010 3300056842 Bacteria 1401665
110 Ga0466706_051926 3300042599 Bacteria 23911
111 Ga0466706_160519 3300042599 Bacteria 5368
112 Ga0466713_140018 3300042602 Bacteria 29586
113 Ga0466716_543822 3300042605 Bacteria 1612
114 Ga0466705_391319 3300042612 Bacteria 1831
115 Ga0466705_434012 3300042612 Bacteria 38552
116 Ga0466723_086329 3300042618 Bacteria 6781
117 Ga0123353_10107403 3300010167 Bacteria 4498
118 Ga0123353_10164557 3300010167 Bacteria 3527
119 Ga0123353_10284536 3300010167 Bacteria 2536
120 Ga0415639_005421 3300038395 Bacteria 25052
121 Ga0466690_322035 3300042590 Bacteria 3548
122 Ga0466731_381062 3300042622 Bacteria 4080
123 Ga0466735_212598 3300042624 Bacteria 3791

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_376398 Ga0466715_376398_196_1212 338
2 3300042612 Ga0466705_358599 Ga0466705_358599_19813_20847 344
3 3300042614 Ga0466712_004801 Ga0466712_004801_10606_11703 344
4 3300042599 Ga0466706_198830 Ga0466706_198830_102_1139 345
5 3300042603 Ga0466714_060675 Ga0466714_060675_86_1180 349
6 3300042619 Ga0466726_027420 Ga0466726_027420_6423_7496 357
7 3300042601 Ga0466707_044763 Ga0466707_044763_209_1285 358
8 3300042608 Ga0466721_210055 Ga0466721_210055_729_1805 358
9 3300002462 JGI24702J35022_10031911 JGI24702J35022_100319112 359
10 3300005200 Ga0072940_1396685 Ga0072940_13966851 359
11 3300010167 Ga0123353_10107403 Ga0123353_101074033 359
12 3300010167 Ga0123353_10524018 Ga0123353_105240181 359
13 3300042593 Ga0466691_148224 Ga0466691_148224_1972_3051 359
14 3300042606 Ga0466719_484742 Ga0466719_484742_3663_4742 359
15 3300005200 Ga0072940_1455191 Ga0072940_14551915 360
16 3300010049 Ga0123356_10207739 Ga0123356_102077391 360
17 3300042605 Ga0466716_461272 Ga0466716_461272_785_1867 360
18 3300042612 Ga0466705_310573 Ga0466705_310573_4138_5220 360
19 3300042612 Ga0466705_434012 Ga0466705_434012_22571_23653 360
20 3300042616 Ga0466715_279443 Ga0466715_279443_11678_12760 360
21 3300042619 Ga0466726_449069 Ga0466726_449069_1143_2225 360
22 3300042601 Ga0466707_336274 Ga0466707_336274_2704_3789 361
23 3300042603 Ga0466714_012619 Ga0466714_012619_9583_10668 361
24 3300042618 Ga0466723_086329 Ga0466723_086329_2846_3931 361
25 3300042636 Ga0466703_177436 Ga0466703_177436_4754_5839 361
26 3300042652 Ga0466708_229225 Ga0466708_229225_1444_2529 361
27 3300042652 Ga0466708_417930 Ga0466708_417930_3587_4672 361
28 3300010049 Ga0123356_10205237 Ga0123356_102052372 362
29 3300010167 Ga0123353_10373983 Ga0123353_103739832 362
30 3300042616 Ga0466715_023530 Ga0466715_023530_4105_5193 362
31 3300042618 Ga0466723_036342 Ga0466723_036342_33_1121 362
32 iso_pr_bacteria 2820272499 2820275017 362
33 3300010167 Ga0123353_10164557 Ga0123353_101645572 363
34 3300010167 Ga0123353_10284536 Ga0123353_102845362 363
35 3300010167 Ga0123353_10473645 Ga0123353_104736452 363
36 3300010167 Ga0123353_10495186 Ga0123353_104951861 363
37 3300042590 Ga0466690_034706 Ga0466690_034706_23948_25039 363
38 3300042602 Ga0466713_039773 Ga0466713_039773_7874_8965 363
39 3300042602 Ga0466713_140018 Ga0466713_140018_6973_8064 363
40 3300042603 Ga0466714_043750 Ga0466714_043750_1584_2675 363
41 3300042603 Ga0466714_107226 Ga0466714_107226_5819_6910 363
42 3300042605 Ga0466716_543822 Ga0466716_543822_49_1140 363
43 3300042615 Ga0466711_109385 Ga0466711_109385_1731_2822 363
44 3300042615 Ga0466711_286486 Ga0466711_286486_1268_2359 363
45 3300042618 Ga0466723_347886 Ga0466723_347886_2323_3414 363
46 3300042624 Ga0466735_212598 Ga0466735_212598_456_1565 363
47 3300042652 Ga0466708_091330 Ga0466708_091330_4088_5179 363
48 iso_pr_bacteria 2820683647 2820685153 363
49 3300002462 JGI24702J35022_10001584 JGI24702J35022_100015845 364
50 3300002462 JGI24702J35022_10147119 JGI24702J35022_101471191 364
51 3300038395 Ga0415639_005421 Ga0415639_005421_7870_8964 364
52 3300038395 Ga0415639_257920 Ga0415639_257920_256_1350 364
53 3300042601 Ga0466707_394085 Ga0466707_394085_290_1384 364
54 3300042605 Ga0466716_468189 Ga0466716_468189_3935_5029 364
55 3300042636 Ga0466703_001811 Ga0466703_001811_911_2005 364
56 3300002450 JGI24695J34938_10003969 JGI24695J34938_100039695 365
57 3300042619 Ga0466726_341155 Ga0466726_341155_376_1473 365
58 3300042622 Ga0466731_381062 Ga0466731_381062_799_1896 365
59 3300042590 Ga0466690_322035 Ga0466690_322035_1105_2205 366
60 3300042599 Ga0466706_172146 Ga0466706_172146_22155_23255 366
61 3300042601 Ga0466707_233067 Ga0466707_233067_215_1315 366
62 3300042602 Ga0466713_134616 Ga0466713_134616_1593_2693 366
63 3300042603 Ga0466714_075322 Ga0466714_075322_1116_2216 366
64 3300042603 Ga0466714_093078 Ga0466714_093078_1296_2396 366
65 3300042604 Ga0466717_028783 Ga0466717_028783_1505_2605 366
66 3300042612 Ga0466705_518747 Ga0466705_518747_7242_8342 366
67 3300042636 Ga0466703_425813 Ga0466703_425813_4273_5373 366
68 3300042643 Ga0466704_161605 Ga0466704_161605_2444_3544 366
69 3300005083 Ga0068305_10005230 Ga0068305_100052306 367
70 3300038395 Ga0415639_003875 Ga0415639_003875_275_1378 367
71 3300042596 Ga0466696_010174 Ga0466696_010174_18924_20027 367
72 3300042599 Ga0466706_046636 Ga0466706_046636_306_1409 367
73 3300042652 Ga0466708_211570 Ga0466708_211570_2835_3938 367
74 3300042652 Ga0466708_321892 Ga0466708_321892_5536_6639 367
75 iso_pr_bacteria 2684622913 2686076269 367
76 iso_pr_bacteria 2758568558 2760423611 367
77 iso_pr_bacteria 2820661146 2820662082 367
78 iso_pr_bacteria 2820690275 2820690980 367
79 iso_pr_bacteria 8017462664 8017462690 367
80 3300002450 JGI24695J34938_10000715 JGI24695J34938_1000071527 368
81 3300002450 JGI24695J34938_10000874 JGI24695J34938_1000087420 368
82 3300010049 Ga0123356_10067622 Ga0123356_100676222 368
83 3300010049 Ga0123356_10114857 Ga0123356_101148571 368
84 3300010049 Ga0123356_10139472 Ga0123356_101394722 368
85 3300010049 Ga0123356_10141716 Ga0123356_101417161 368
86 3300010049 Ga0123356_10142904 Ga0123356_101429042 368
87 3300010049 Ga0123356_10145035 Ga0123356_101450353 368
88 3300010049 Ga0123356_10286629 Ga0123356_102866292 368
89 3300042612 Ga0466705_391319 Ga0466705_391319_164_1270 368
90 3300042636 Ga0466703_000993 Ga0466703_000993_286_1392 368
91 3300042643 Ga0466704_069430 Ga0466704_069430_125_1231 368
92 iso_pr_bacteria 8007237282 8007238010 368
93 3300010049 Ga0123356_10009427 Ga0123356_100094277 369
94 3300010167 Ga0123353_10260499 Ga0123353_102604991 369
95 3300042593 Ga0466691_046095 Ga0466691_046095_2720_3829 369
96 3300042593 Ga0466691_148361 Ga0466691_148361_2267_3376 369
97 3300042593 Ga0466691_220365 Ga0466691_220365_2117_3226 369
98 3300042603 Ga0466714_060377 Ga0466714_060377_1727_2836 369
99 3300042655 Ga0466727_215100 Ga0466727_215100_1404_2513 369
100 iso_pr_bacteria 2511231129 2511729639 369
101 3300005318 Ga0074188_1000238 Ga0074188_100023812 370
102 3300038395 Ga0415639_019554 Ga0415639_019554_10366_11478 370
103 3300042599 Ga0466706_160519 Ga0466706_160519_3164_4276 370
104 3300042636 Ga0466703_172414 Ga0466703_172414_1047_2159 370
105 3300056790 Ga0562379_0005 Ga0562379_0005_1741876_1742988 370
106 iso_pr_bacteria 2775507073 2777018399 370
107 iso_pr_bacteria 2940380068 2940384919 370
108 iso_pr_bacteria 2940386776 2940391596 370
109 iso_pr_bacteria 2940393498 2940398330 370
110 iso_pr_bacteria 2940400224 2940405069 370
111 iso_pr_bacteria 2940406939 2940411556 370
112 3300042618 Ga0466723_150183 Ga0466723_150183_3024_4139 371
113 iso_pr_bacteria 2820457604 2820457762 371
114 iso_pr_bacteria 2820666966 2820669013 371
115 iso_pr_bacteria 2881375749 2881375967 371
116 2225789004 2227158569 2227567148 372
117 3300010167 Ga0123353_10001649 Ga0123353_1000164923 372
118 3300042599 Ga0466706_051926 Ga0466706_051926_3228_4346 372
119 iso_pr_bacteria 8017458139 8017460349 372
120 3300000062 IMNBL1DRAFT_c0000002 IMNBL1DRAFT_0000002316 373
121 3300005083 Ga0068305_10027785 Ga0068305_100277852 373
122 3300009826 Ga0123355_10089382 Ga0123355_100893826 373
123 3300042620 Ga0466728_192504 Ga0466728_192504_7156_8277 373
124 3300056790 Ga0562379_0009 Ga0562379_0009_1649774_1650895 373
125 3300056790 Ga0562379_0011 Ga0562379_0011_1577801_1578922 373
126 3300056790 Ga0562379_0329 Ga0562379_0329_39508_40629 373
127 3300056790 Ga0562379_0346 Ga0562379_0346_44115_45236 373
128 3300056814 Ga0562378_1823 Ga0562378_1823_6013_7134 373
129 3300056842 Ga0562377_0010 Ga0562377_0010_421276_422397 373
130 3300042618 Ga0466723_131965 Ga0466723_131965_2172_3299 375
131 3300042616 Ga0466715_045335 Ga0466715_045335_7631_8761 376
132 3300042599 Ga0466706_185672 Ga0466706_185672_1977_3110 377
133 3300042599 Ga0466706_088277 Ga0466706_088277_12203_13339 378
134 3300009784 Ga0123357_10267663 Ga0123357_102676632 379
135 3300038395 Ga0415639_005382 Ga0415639_005382_10870_12012 380
136 3300042599 Ga0466706_052481 Ga0466706_052481_16367_17509 380
137 3300042598 Ga0466701_094818 Ga0466701_094818_1477_2622 381
138 3300010049 Ga0123356_10227989 Ga0123356_102279892 383
139 3300042599 Ga0466706_205550 Ga0466706_205550_5923_7074 383
140 3300042599 Ga0466706_062227 Ga0466706_062227_1568_2725 385
141 3300056856 Ga0562375_0012 Ga0562375_0012_93255_94412 385
142 3300042592 Ga0466693_278666 Ga0466693_278666_56_1231 391

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03275 GLF UDP-galactopyranose mutase 173 373 0.99
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 35 101 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03275 GO:0008767 UDP-galactopyranose mutase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.