Protein Family IF04783

Metagenome Isolate
148 Members
58 Samples
139 Scaffolds
413.74 Avg Length

🧬 Representative Sequence

ID
3300042592|Ga0466693_206267|Ga0466693_206267_384_1688
Length
434 aa
Sequence
MLKKCKVKRSKSVKRLDMEYIKRLTDNELERKVNSSGAVLVRGAKACGKTESAKQVAGSILKVDQDEQVSTMMELSPKRLLLGKTPRLIDEWQEYPKLWNYVRHEIDDRQQTAQFILTGSANPVESVKMHSGAGRFTTLDMRTMSWQELGFSSGKVSMNSLFEGAKIDIFDETTKLEFIVEKIITGGFPALIGKSKNQAVDLNRAYIDLLAEVDMSRVSNVKRDPVKVKNLLRSIARNTANIVDIATLATDIREKENSDISRPTIYEYMDALNRLMIIEEQPAWNPHIRSSASLRKSSKIHFTDVSLSVAALGIDAKSLFNNLPLTGFLFESMVTHDLRVYAQANDAKVYYYRDSSRLEVDAIVQKRNGDWIAFEIKLGTAQIEEAAANLKKFVSILDPQKVKLPQSLNIITGTGMSYTRADGINVISFASLGA

📊 Sample Types

Isolate 6.1%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.6%
Unclassified 19.6%
Kalotermitidae 19.6%
Rhinotermitidae 5.4%
Termopsidae 5.4%
Passalidae 3.6%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 6
Bacteria 130
Eukaryota 0
Viruses 1
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
24 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
27 2684622742 Methanobrevibacter curvatus DSM11111 Isolate Unclassified
28 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
29 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
32 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
33 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
34 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
40 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
45 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
48 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
49 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
50 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
51 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
52 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
53 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
54 2773857693 Methanobrevibacter sp. Th196P3bin91 Isolate Unclassified
55 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
56 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
57 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
58 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_074228 3300042611 Bacteria 2605
2 Ga0466733_197983 3300042659 Unclassified 1672
3 Ga0466715_199024 3300042616 Bacteria 1882
4 Ga0466728_023392 3300042620 Bacteria 6171
5 Ga0264413_156213 3300024493 Unclassified 1256
6 Ga0466693_311529 3300042592 Archaea 1526
7 Ga0466693_378272 3300042592 Bacteria 1503
8 Ga0466696_399378 3300042596 Bacteria 3876
9 Ga0466707_032774 3300042601 Bacteria 8445
10 Ga0466722_080395 3300042609 Bacteria 2657
11 Ga0466698_167739 3300042610 Bacteria 1707
12 Ga0123356_10278579 3300010049 Bacteria 1766
13 Ga0123353_10007351 3300010167 Bacteria 14863
14 Ga0123353_10014473 3300010167 Bacteria 11377
15 Ga0123354_10056341 3300010882 Bacteria 5869
16 Ga0123354_10120006 3300010882 Bacteria 3402
17 Ga0466703_037426 3300042636 Bacteria 4903
18 Ga0466704_224670 3300042643 Unclassified 6383
19 Ga0466704_233062 3300042643 Bacteria 8217
20 JGI24702J35022_10000285 3300002462 Bacteria 29611
21 Ga0072941_1007931 3300005201 Bacteria 36883
22 Ga0072941_1206951 3300005201 Bacteria 1734
23 Ga0466697_199885 3300042611 Archaea 5176
24 Ga0466705_313720 3300042612 Bacteria 20707
25 Ga0466705_365617 3300042612 Bacteria 5503
26 Ga0466705_418159 3300042612 Bacteria 1732
27 Ga0466712_003192 3300042614 Bacteria 3920
28 Ga0466711_038772 3300042615 Bacteria 2159
29 Ga0466711_348105 3300042615 Bacteria 31872
30 Ga0466693_022521 3300042592 Bacteria 1626
31 Ga0466707_227267 3300042601 Bacteria 2899
32 Ga0466713_145871 3300042602 Bacteria 6543
33 Ga0466698_465325 3300042610 Bacteria 2591
34 Ga0123356_10001880 3300010049 Bacteria 22763
35 Ga0123354_10114687 3300010882 Bacteria 3528
36 Ga0466709_239776 3300042648 Bacteria 4855
37 2227175252 2225789004 Bacteria 8140
38 2227300233 2225789004 Bacteria 6611
39 IMNBL1DRAFT_c0012080 3300000062 Bacteria 3976
40 JGI24702J35022_10003795 3300002462 Bacteria 9076
41 JGI24702J35022_10010224 3300002462 Bacteria 5253
42 JGI24702J35022_10047912 3300002462 Bacteria 2275
43 Ga0466733_040060 3300042659 Unclassified 12215
44 Ga0466715_379258 3300042616 Bacteria 7972
45 Ga0466690_134365 3300042590 Bacteria 3779
46 Ga0466692_157497 3300042591 Bacteria 4127
47 Ga0466693_206267 3300042592 Bacteria 2154
48 Ga0466722_123031 3300042609 Bacteria 32122
49 Ga0123357_10314077 3300009784 Archaea 1560
50 Ga0123353_10439679 3300010167 Bacteria 1925
51 Ga0123354_10143780 3300010882 Bacteria 2933
52 Ga0123354_10236816 3300010882 Bacteria 1890
53 Ga0068302_10093387 3300005071 Bacteria 2705
54 Ga0466705_058135 3300042612 Bacteria 5638
55 Ga0466705_149104 3300042612 Bacteria 2599
56 Ga0466732_017838 3300042656 Bacteria 18220
57 Ga0466710_427335 3300042613 Bacteria 1733
58 Ga0466712_143288 3300042614 Bacteria 2602
59 Ga0466726_359877 3300042619 Bacteria 4032
60 Ga0466694_071352 3300042594 Bacteria 1798
61 Ga0466694_075344 3300042594 Bacteria 2890
62 Ga0466696_431058 3300042596 Bacteria 1987
63 Ga0466707_345434 3300042601 Bacteria 28806
64 Ga0466714_088054 3300042603 Bacteria 1558
65 Ga0466714_161869 3300042603 Bacteria 1524
66 Ga0466719_029948 3300042606 Bacteria 4303
67 Ga0466719_448902 3300042606 Bacteria 1996
68 Ga0123357_10153271 3300009784 Bacteria 2788
69 Ga0123357_10227395 3300009784 Bacteria 2054
70 Ga0123353_10081350 3300010167 Bacteria 5208
71 Ga0123354_10000498 3300010882 Bacteria 39457
72 Ga0123354_10158948 3300010882 Unclassified 2694
73 Ga0466731_016710 3300042622 Bacteria 3442
74 Ga0466727_176744 3300042655 Bacteria 4766
75 IMNBL1DRAFT_c0006335 3300000062 Bacteria 6486
76 AustNasuHG_c1000173 3300000089 Bacteria 20878
77 JGI24702J35022_10002337 3300002462 Bacteria 11593
78 Ga0068305_10228728 3300005083 Bacteria 1418
79 Ga0466711_126492 3300042615 Unclassified 7082
80 Ga0466715_410456 3300042616 Bacteria 8403
81 Ga0264413_160880 3300024493 Unclassified 1383
82 Ga0466690_160604 3300042590 Bacteria 4774
83 Ga0466693_115105 3300042592 Bacteria 1633
84 Ga0466706_013300 3300042599 Archaea 7943
85 Ga0466707_198760 3300042601 Bacteria 3186
86 Ga0466714_058710 3300042603 Bacteria 109931
87 Ga0466721_080432 3300042608 Bacteria 1645
88 Ga0466721_349002 3300042608 Bacteria 1753
89 Ga0123356_10057548 3300010049 Bacteria 3624
90 Ga0123353_10413871 3300010167 Bacteria 2000
91 Ga0123353_10641989 3300010167 Bacteria 1505
92 Ga0466729_211515 3300042621 Bacteria 3912
93 Ga0466731_127142 3300042622 Bacteria 1694
94 Ga0466703_196407 3300042636 Bacteria 1649
95 2227474637 2225789004 Bacteria 22737
96 JGI24695J34938_10060399 3300002450 Bacteria 1618
97 JGI24702J35022_10046550 3300002462 Bacteria 2310
98 JGI24705J35276_12235011 3300002504 Bacteria 6076
99 Ga0068305_10035221 3300005083 Unclassified 2716
100 Ga0466697_104875 3300042611 Bacteria 1734
101 Ga0466718_032061 3300042617 Unclassified 13031
102 Ga0466726_048500 3300042619 Bacteria 17749
103 Ga0466690_083978 3300042590 Bacteria 4395
104 Ga0466713_126739 3300042602 Bacteria 2891
105 Ga0466722_039281 3300042609 Bacteria 1854
106 Ga0123357_10046187 3300009784 Unclassified 5908
107 Ga0123356_10421695 3300010049 Bacteria 1477
108 Ga0466731_016352 3300042622 Bacteria 1766
109 Ga0466734_157707 3300042623 Bacteria 1589
110 Ga0466703_158285 3300042636 Bacteria 84792
111 Ga0466703_185589 3300042636 Bacteria 16758
112 Ga0068302_10033108 3300005071 Bacteria 10829
113 Ga0466705_008587 3300042612 Bacteria 6762
114 Ga0466729_046364 3300042621 Bacteria 2414
115 Ga0466657_314321 3300042582 Bacteria 1736
116 Ga0466693_178903 3300042592 Bacteria 3681
117 Ga0466706_081618 3300042599 Unclassified 1422
118 Ga0466707_155045 3300042601 Bacteria 5083
119 Ga0466719_022099 3300042606 Bacteria 7722
120 Ga0466719_512201 3300042606 Bacteria 4300
121 Ga0123356_10030682 3300010049 Bacteria 5031
122 Ga0123353_10000023 3300010167 Bacteria 173512
123 Ga0123353_10225647 3300010167 Bacteria 2925
124 Ga0123353_10446210 3300010167 Bacteria 1907
125 Ga0466725_427742 3300042654 Bacteria 6844
126 JGI24702J35022_10040447 3300002462 Bacteria 2486
127 Ga0466705_096788 3300042612 Bacteria 4916
128 Ga0466726_087159 3300042619 Bacteria 3726
129 Ga0466694_169164 3300042594 Bacteria 1824
130 Ga0466713_052034 3300042602 Bacteria 14972
131 Ga0466716_130656 3300042605 Bacteria 2204
132 Ga0466719_165133 3300042606 Bacteria 3034
133 Ga0466720_003619 3300042607 Bacteria 6109
134 Ga0123355_10049676 3300009826 Bacteria 6818
135 Ga0123356_10029200 3300010049 Bacteria 5167
136 Ga0123356_10108697 3300010049 Viruses 2675
137 Ga0123353_10018001 3300010167 Bacteria 10422
138 Ga0123353_10198346 3300010167 Bacteria 3161
139 Ga0123354_10097175 3300010882 Bacteria 4016

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_149104 Ga0466705_149104_12_1100 362
2 3300042613 Ga0466710_427335 Ga0466710_427335_611_1699 362
3 3300042636 Ga0466703_196407 Ga0466703_196407_10_1098 362
4 3300042602 Ga0466713_126739 Ga0466713_126739_1759_2859 366
5 3300042617 Ga0466718_032061 Ga0466718_032061_8117_9235 372
6 iso_pr_bacteria 2820772500 2820774228 375
7 3300024493 Ga0264413_156213 Ga0264413_1562131 380
8 3300042607 Ga0466720_003619 Ga0466720_003619_4593_5738 381
9 3300042619 Ga0466726_087159 Ga0466726_087159_2077_3312 386
10 3300005083 Ga0068305_10228728 Ga0068305_102287281 388
11 3300042619 Ga0466726_359877 Ga0466726_359877_2820_3986 388
12 3300042606 Ga0466719_448902 Ga0466719_448902_674_1855 393
13 3300042655 Ga0466727_176744 Ga0466727_176744_202_1464 398
14 3300042590 Ga0466690_160604 Ga0466690_160604_672_1925 402
15 3300042606 Ga0466719_029948 Ga0466719_029948_2097_3350 403
16 3300042612 Ga0466705_365617 Ga0466705_365617_3955_5208 403
17 3300042612 Ga0466705_058135 Ga0466705_058135_3166_4416 404
18 3300042659 Ga0466733_040060 Ga0466733_040060_1639_2862 407
19 3300042659 Ga0466733_197983 Ga0466733_197983_28_1251 407
20 3300042592 Ga0466693_115105 Ga0466693_115105_78_1304 408
21 3300042614 Ga0466712_003192 Ga0466712_003192_2555_3790 411
22 3300042636 Ga0466703_185589 Ga0466703_185589_819_2054 411
23 3300024493 Ga0264413_160880 Ga0264413_1608801 412
24 3300042590 Ga0466690_083978 Ga0466690_083978_2060_3298 412
25 3300042621 Ga0466729_046364 Ga0466729_046364_961_2199 412
26 3300010167 Ga0123353_10439679 Ga0123353_104396791 413
27 3300010167 Ga0123353_10446210 Ga0123353_104462102 413
28 3300042603 Ga0466714_088054 Ga0466714_088054_25_1269 414
29 3300042603 Ga0466714_161869 Ga0466714_161869_206_1450 414
30 3300042611 Ga0466697_199885 Ga0466697_199885_1420_2664 414
31 3300042616 Ga0466715_199024 Ga0466715_199024_325_1569 414
32 3300042615 Ga0466711_348105 Ga0466711_348105_20124_21371 415
33 3300042590 Ga0466690_134365 Ga0466690_134365_1958_3208 416
34 3300042596 Ga0466696_399378 Ga0466696_399378_1964_3214 416
35 3300042596 Ga0466696_431058 Ga0466696_431058_626_1876 416
36 3300042601 Ga0466707_198760 Ga0466707_198760_1654_2904 416
37 3300042612 Ga0466705_008587 Ga0466705_008587_2054_3304 416
38 3300042654 Ga0466725_427742 Ga0466725_427742_5439_6689 416
39 2225789004 2227175252 2227590978 417
40 2225789004 2227300233 2227750257 417
41 2225789004 2227474637 2227925269 417
42 3300010167 Ga0123353_10000023 Ga0123353_1000002379 417
43 3300042582 Ga0466657_314321 Ga0466657_314321_26_1279 417
44 3300042591 Ga0466692_157497 Ga0466692_157497_2477_3730 417
45 3300042592 Ga0466693_022521 Ga0466693_022521_247_1500 417
46 3300042592 Ga0466693_178903 Ga0466693_178903_1568_2821 417
47 3300042592 Ga0466693_378272 Ga0466693_378272_168_1421 417
48 3300042594 Ga0466694_071352 Ga0466694_071352_95_1348 417
49 3300042594 Ga0466694_075344 Ga0466694_075344_1002_2255 417
50 3300042594 Ga0466694_169164 Ga0466694_169164_231_1484 417
51 3300042601 Ga0466707_032774 Ga0466707_032774_4692_5945 417
52 3300042601 Ga0466707_227267 Ga0466707_227267_206_1459 417
53 3300042601 Ga0466707_345434 Ga0466707_345434_8612_9865 417
54 3300042602 Ga0466713_145871 Ga0466713_145871_287_1540 417
55 3300042605 Ga0466716_130656 Ga0466716_130656_766_2019 417
56 3300042606 Ga0466719_022099 Ga0466719_022099_2323_3576 417
57 3300042606 Ga0466719_512201 Ga0466719_512201_2539_3792 417
58 3300042608 Ga0466721_080432 Ga0466721_080432_278_1531 417
59 3300042608 Ga0466721_349002 Ga0466721_349002_333_1586 417
60 3300042609 Ga0466722_039281 Ga0466722_039281_368_1621 417
61 3300042609 Ga0466722_080395 Ga0466722_080395_644_1897 417
62 3300042609 Ga0466722_123031 Ga0466722_123031_20677_21930 417
63 3300042610 Ga0466698_167739 Ga0466698_167739_283_1536 417
64 3300042610 Ga0466698_465325 Ga0466698_465325_541_1794 417
65 3300042611 Ga0466697_074228 Ga0466697_074228_190_1443 417
66 3300042611 Ga0466697_104875 Ga0466697_104875_385_1638 417
67 3300042612 Ga0466705_096788 Ga0466705_096788_2400_3653 417
68 3300042612 Ga0466705_418159 Ga0466705_418159_94_1347 417
69 3300042614 Ga0466712_143288 Ga0466712_143288_310_1563 417
70 3300042615 Ga0466711_126492 Ga0466711_126492_4594_5847 417
71 3300042616 Ga0466715_379258 Ga0466715_379258_3457_4710 417
72 3300042619 Ga0466726_048500 Ga0466726_048500_7130_8383 417
73 3300042620 Ga0466728_023392 Ga0466728_023392_752_2005 417
74 3300042622 Ga0466731_016352 Ga0466731_016352_259_1512 417
75 3300042622 Ga0466731_016710 Ga0466731_016710_704_1957 417
76 3300042622 Ga0466731_127142 Ga0466731_127142_381_1634 417
77 3300042623 Ga0466734_157707 Ga0466734_157707_201_1454 417
78 3300042636 Ga0466703_037426 Ga0466703_037426_559_1812 417
79 3300042643 Ga0466704_224670 Ga0466704_224670_3741_4994 417
80 3300042643 Ga0466704_233062 Ga0466704_233062_5480_6733 417
81 3300042648 Ga0466709_239776 Ga0466709_239776_2290_3543 417
82 3300042656 Ga0466732_017838 Ga0466732_017838_4631_5884 417
83 iso_pr_bacteria 2820719201 2820721169 417
84 iso_pr_bacteria 2820765201 2820767023 417
85 iso_pr_bacteria 2820767225 2820767367 417
86 iso_pr_bacteria 2820770630 2820771495 417
87 iso_pr_bacteria 2820772500 2820773945 417
88 3300000062 IMNBL1DRAFT_c0006335 IMNBL1DRAFT_00063357 418
89 3300000089 AustNasuHG_c1000173 AustNasuHG_100017315 418
90 3300002462 JGI24702J35022_10003795 JGI24702J35022_100037954 418
91 3300002462 JGI24702J35022_10010224 JGI24702J35022_100102243 418
92 3300002462 JGI24702J35022_10040447 JGI24702J35022_100404472 418
93 3300002462 JGI24702J35022_10046550 JGI24702J35022_100465502 418
94 3300002462 JGI24702J35022_10047912 JGI24702J35022_100479122 418
95 3300002504 JGI24705J35276_12235011 JGI24705J35276_122350115 418
96 3300005071 Ga0068302_10093387 Ga0068302_100933872 418
97 3300005201 Ga0072941_1007931 Ga0072941_100793119 418
98 3300005201 Ga0072941_1206951 Ga0072941_12069511 418
99 3300009784 Ga0123357_10046187 Ga0123357_100461877 418
100 3300009784 Ga0123357_10153271 Ga0123357_101532712 418
101 3300009784 Ga0123357_10227395 Ga0123357_102273952 418
102 3300010049 Ga0123356_10001880 Ga0123356_1000188011 418
103 3300010049 Ga0123356_10029200 Ga0123356_100292002 418
104 3300010049 Ga0123356_10030682 Ga0123356_100306823 418
105 3300010049 Ga0123356_10057548 Ga0123356_100575484 418
106 3300010049 Ga0123356_10108697 Ga0123356_101086972 418
107 3300010049 Ga0123356_10278579 Ga0123356_102785791 418
108 3300010167 Ga0123353_10014473 Ga0123353_100144733 418
109 3300010167 Ga0123353_10018001 Ga0123353_100180015 418
110 3300010167 Ga0123353_10081350 Ga0123353_100813504 418
111 3300010167 Ga0123353_10198346 Ga0123353_101983463 418
112 3300010167 Ga0123353_10225647 Ga0123353_102256472 418
113 3300010167 Ga0123353_10413871 Ga0123353_104138712 418
114 3300010167 Ga0123353_10641989 Ga0123353_106419891 418
115 3300010882 Ga0123354_10000498 Ga0123354_1000049847 418
116 3300010882 Ga0123354_10056341 Ga0123354_100563412 418
117 3300010882 Ga0123354_10097175 Ga0123354_100971753 418
118 3300010882 Ga0123354_10114687 Ga0123354_101146872 418
119 3300010882 Ga0123354_10120006 Ga0123354_101200061 418
120 3300010882 Ga0123354_10143780 Ga0123354_101437803 418
121 3300010882 Ga0123354_10158948 Ga0123354_101589482 418
122 3300010882 Ga0123354_10236816 Ga0123354_102368162 418
123 3300042599 Ga0466706_081618 Ga0466706_081618_72_1328 418
124 3300042603 Ga0466714_058710 Ga0466714_058710_81115_82371 418
125 iso_pr_bacteria 2820735654 2820735746 418
126 3300002462 JGI24702J35022_10000285 JGI24702J35022_100002857 419
127 3300002462 JGI24702J35022_10002337 JGI24702J35022_100023377 419
128 3300009826 Ga0123355_10049676 Ga0123355_100496767 419
129 3300010049 Ga0123356_10421695 Ga0123356_104216952 419
130 3300042592 Ga0466693_311529 Ga0466693_311529_46_1305 419
131 3300042602 Ga0466713_052034 Ga0466713_052034_11239_12498 419
132 3300042616 Ga0466715_410456 Ga0466715_410456_217_1476 419
133 iso_pu_archaea 2773857693 2774167960 419
134 3300005083 Ga0068305_10035221 Ga0068305_100352211 420
135 3300009784 Ga0123357_10314077 Ga0123357_103140771 420
136 3300010167 Ga0123353_10007351 Ga0123353_100073512 420
137 3300042612 Ga0466705_313720 Ga0466705_313720_1052_2314 420
138 3300042636 Ga0466703_158285 Ga0466703_158285_16390_17652 420
139 3300042615 Ga0466711_038772 Ga0466711_038772_222_1487 421
140 3300002450 JGI24695J34938_10060399 JGI24695J34938_100603991 422
141 3300042599 Ga0466706_013300 Ga0466706_013300_2025_3293 422
142 3300042601 Ga0466707_155045 Ga0466707_155045_199_1467 422
143 iso_pu_archaea 2684622742 2685521147 422
144 3300005071 Ga0068302_10033108 Ga0068302_100331086 423
145 3300042606 Ga0466719_165133 Ga0466719_165133_464_1738 424
146 3300000062 IMNBL1DRAFT_c0012080 IMNBL1DRAFT_00120804 428
147 3300042592 Ga0466693_206267 Ga0466693_206267_384_1688 434
148 3300042621 Ga0466729_211515 Ga0466729_211515_1573_2919 448

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13635 DUF4143 Domain of unknown function (DUF4143) 213 378 0.96
PF13173 AAA_14 AAA domain 37 149 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.92 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.