Protein Family IF04714

Metagenome Isolate
242 Members
93 Samples
218 Scaffolds
594.72 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_168759|Ga0466692_168759_3469_5409
Length
646 aa
Sequence
MSERGVYQPYRPIEPGVSEGQAQRLIDLRMTGICLRVIRNLFERKMKENKPIDLSAILSAIPESPGVYMHLDENETIIYVGKAKNLKKRVSSYFNKTQDHPKTRMMVRKIRNIRYLVVESEEDAFLLENNLIKEHQPRYNMMLKDDKTYPWIVVKNEPFPRIFLTRRKIDDKSRYYGPYTSALAVRQLLRFLTSLYPIRICNHKLTQENIEKGKFRVCLQYHIKKCLGPCAGRQPEEDYRNSVQVIEEILKGNSKEMSRLLYKNMMRLASEMRFEEAAVLKERYEMLENYSAKSIVASPSLNNVDVFSFDEDKQSAYINYLHIANGAIIRGYTIEYRKQMDETMENILAMGIIELRTRFESRAKEVIVPFLPDVELSGAEWTVPQRGEKKKLLELSEKNVRQYKLDQLKQAEKLNPEQRTTRILKTLQDDLHLKELPVHIECFDNSNIQGTHPVSACVVFKKARPSKKDYRHFNIKTVVGPDDFGSMYETVFRRYKRLSEEEQPLPQLLVIDGGKGQLHAAADALKDLGLYGRIPLIGIAKRLEEIYFPTDPVPLYLDKNSESLRLIQQLRDEAHRFGITFHRKKRSRQQIASELDAIKGIGPVVKEKLLKKYKSVKKIKEASPAEIVECIGPKKAEALFRGFRPS

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 26.7%
Unclassified 15.6%
Kalotermitidae 15.6%
Blattidae 7.8%
Armadillidiidae 6.7%
Culicidae 5.6%
Rhinotermitidae 4.4%
Termopsidae 4.4%
Formicidae 3.3%
Passalidae 2.2%
Drosophilidae 2.2%
Tenebrionidae 2.2%
Hydrophilidae 2.2%
Daphniidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 234
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
3 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
4 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
7 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
17 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
18 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
19 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
20 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
21 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
22 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
23 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
24 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
25 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
26 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
27 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
28 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
32 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
33 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
34 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
40 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
41 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
42 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
45 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
46 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
47 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
53 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
54 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
55 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
56 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
57 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
58 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
59 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
60 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
61 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
62 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
63 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
64 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
65 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
66 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
67 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
68 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
69 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
70 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
71 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
72 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
73 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
74 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
75 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
76 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
77 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
78 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
79 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
80 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
81 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
82 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
83 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
84 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
85 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
86 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
87 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
88 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
89 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
90 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
91 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
92 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
93 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160455_100105 3300012837 Bacteria 123596
2 Ga0160445_100249 3300012847 Bacteria 38513
3 Ga0466657_210485 3300042582 Bacteria 22461
4 Ga0466735_055931 3300042624 Bacteria 6840
5 Ga0466708_283752 3300042652 Bacteria 2678
6 Ga0466727_045994 3300042655 Bacteria 9519
7 Ga0466701_021511 3300042598 Bacteria 8152
8 Ga0466700_119831 3300042600 Bacteria 20318
9 Ga0466700_282668 3300042600 Bacteria 5041
10 Ga0466713_007433 3300042602 Bacteria 8152
11 Ga0466713_124887 3300042602 Bacteria 13976
12 Ga0466713_156423 3300042602 Bacteria 30043
13 Ga0466714_066823 3300042603 Bacteria 4020
14 Ga0466722_227168 3300042609 Bacteria 3234
15 Ga0123356_10020734 3300010049 Bacteria 6216
16 2227477413 2225789004 Unclassified 22366
17 Ga0123357_10000085 3300009784 Bacteria 75372
18 Ga0160458_100109 3300012832 Bacteria 83580
19 Ga0466691_005260 3300042593 Bacteria 8051
20 Ga0466691_031423 3300042593 Bacteria 2130
21 Ga0466696_049113 3300042596 Bacteria 63300
22 Ga0466729_208225 3300042621 Bacteria 6570
23 Ga0466729_223968 3300042621 Bacteria 5984
24 Ga0466735_186532 3300042624 Bacteria 3048
25 Ga0466735_194728 3300042624 Bacteria 5144
26 Ga0466703_135121 3300042636 Bacteria 3733
27 Ga0466704_307788 3300042643 Bacteria 15366
28 Ga0466709_233448 3300042648 Bacteria 27682
29 Ga0466711_032287 3300042615 Bacteria 10941
30 Ga0466715_368883 3300042616 Bacteria 6573
31 Ga0466723_023375 3300042618 Bacteria 9981
32 Ga0466726_428257 3300042619 Bacteria 2063
33 Ga0466726_436531 3300042619 Bacteria 3715
34 Ga0466728_430369 3300042620 Bacteria 8443
35 Ga0466701_094285 3300042598 Unclassified 4559
36 Ga0466713_000880 3300042602 Bacteria 20825
37 Ga0466713_143771 3300042602 Bacteria 14894
38 Ga0466719_326107 3300042606 Bacteria 2727
39 Ga0466719_567749 3300042606 Bacteria 5679
40 Ga0123357_10032404 3300009784 Bacteria 7098
41 Ga0123357_10037303 3300009784 Bacteria 6615
42 Ga0123357_10248477 3300009784 Bacteria 1909
43 Ga0123353_10103210 3300010167 Bacteria 4596
44 Ga0104045_1005542 3300007085 Bacteria 8024
45 Ga0123357_10000678 3300009784 Bacteria 34027
46 Ga0466697_096879 3300042611 Bacteria 330838
47 Ga0466697_113220 3300042611 Bacteria 2180
48 Ga0466705_056487 3300042612 Bacteria 11616
49 Ga0466705_325670 3300042612 Bacteria 11515
50 Ga0466732_277433 3300042656 Bacteria 43245
51 Ga0466733_150639 3300042659 Bacteria 185699
52 Ga0466690_018936 3300042590 Bacteria 8628
53 Ga0466690_090432 3300042590 Bacteria 9970
54 Ga0466691_018749 3300042593 Bacteria 6098
55 Ga0466696_225169 3300042596 Bacteria 26389
56 Ga0466729_215003 3300042621 Bacteria 1929
57 Ga0466735_128327 3300042624 Bacteria 3173
58 Ga0466704_460153 3300042643 Bacteria 10237
59 Ga0466724_02195 3300042649 Bacteria 8328
60 Ga0466727_261708 3300042655 Bacteria 3733
61 Ga0466723_051232 3300042618 Bacteria 14582
62 Ga0466726_234425 3300042619 Bacteria 6071
63 Ga0466701_055658 3300042598 Bacteria 38151
64 Ga0466713_096596 3300042602 Bacteria 406546
65 Ga0466714_084657 3300042603 Bacteria 3504
66 Ga0123353_10074106 3300010167 Bacteria 5472
67 Ga0160465_100010 3300012803 Bacteria 359268
68 Ga0160465_100020 3300012803 Bacteria 253724
69 IMNBL1DRAFT_c0002721 3300000062 Bacteria 12041
70 IMNBL1DRAFT_c0010343 3300000062 Bacteria 4483
71 JGI24702J35022_10003984 3300002462 Bacteria 8862
72 JGI24702J35022_10043892 3300002462 Bacteria 2382
73 JGI24699J35502_11133640 3300002509 Bacteria 12852
74 JGI24699J35502_11134138 3300002509 Bacteria 36202
75 Ga0068302_10101704 3300005071 Bacteria 4872
76 Ga0068305_10182627 3300005083 Unclassified 5839
77 Ga0123357_10001874 3300009784 Bacteria 22834
78 Ga0466705_043883 3300042612 Bacteria 44680
79 Ga0466733_155754 3300042659 Bacteria 9808
80 Ga0562377_0004 3300056842 Bacteria 3525959
81 Ga0160455_100016 3300012837 Bacteria 470507
82 Ga0160460_100013 3300012845 Bacteria 460073
83 Ga0160433_101849 3300012846 Bacteria 5147
84 Ga0160435_1000114 3300012857 Unclassified 46673
85 Ga0466690_006457 3300042590 Bacteria 3708
86 Ga0466692_073863 3300042591 Bacteria 38781
87 Ga0466693_116857 3300042592 Bacteria 1991
88 Ga0466699_284338 3300042597 Bacteria 1698
89 Ga0466703_045010 3300042636 Bacteria 4958
90 Ga0466703_091103 3300042636 Bacteria 2765
91 Ga0466703_158987 3300042636 Bacteria 11731
92 Ga0466703_204119 3300042636 Bacteria 8700
93 Ga0466703_305891 3300042636 Bacteria 3380
94 Ga0466724_28891 3300042649 Bacteria 455231
95 Ga0466711_120138 3300042615 Bacteria 6212
96 Ga0466711_403972 3300042615 Bacteria 61875
97 Ga0466715_076767 3300042616 Bacteria 23423
98 Ga0466715_159345 3300042616 Bacteria 29954
99 Ga0466715_358257 3300042616 Bacteria 24317
100 Ga0466701_052765 3300042598 Bacteria 148853
101 Ga0466707_136654 3300042601 Bacteria 15946
102 Ga0466707_144321 3300042601 Bacteria 17726
103 Ga0466707_187402 3300042601 Bacteria 29769
104 Ga0466707_221537 3300042601 Bacteria 3794
105 Ga0466713_096507 3300042602 Bacteria 18345
106 Ga0466716_175246 3300042605 Bacteria 20455
107 Ga0123356_10005286 3300010049 Bacteria 13177
108 Ga0123354_10000186 3300010882 Bacteria 52457
109 Ga0123354_10078104 3300010882 Bacteria 4708
110 2227507947 2225789004 Bacteria 71292
111 IMNBL1DRAFT_c0000785 3300000062 Bacteria 25114
112 JGI24705J35276_12223922 3300002504 Bacteria 2558
113 JGI24705J35276_12238036 3300002504 Bacteria 15194
114 JGI24699J35502_11134056 3300002509 Bacteria 27277
115 Ga0123357_10001340 3300009784 Bacteria 26023
116 Ga0466733_028910 3300042659 Bacteria 2573
117 Ga0160469_100013 3300012824 Bacteria 444998
118 Ga0160433_100012 3300012846 Bacteria 265415
119 Ga0160445_100591 3300012847 Unclassified 15909
120 Ga0466690_322261 3300042590 Bacteria 21248
121 Ga0466690_378263 3300042590 Bacteria 22561
122 Ga0466692_168038 3300042591 Bacteria 2784
123 Ga0466692_168759 3300042591 Bacteria 5576
124 Ga0466691_095154 3300042593 Bacteria 7390
125 Ga0466696_486478 3300042596 Bacteria 1815
126 Ga0466701_000462 3300042598 Bacteria 39838
127 Ga0466730_054806 3300042625 Bacteria 801523
128 Ga0466704_053113 3300042643 Bacteria 15533
129 Ga0466704_577848 3300042643 Bacteria 5648
130 Ga0466710_174404 3300042613 Bacteria 6957
131 Ga0466710_392961 3300042613 Bacteria 3606
132 Ga0466710_423219 3300042613 Bacteria 1956
133 Ga0466711_070021 3300042615 Bacteria 21814
134 Ga0466715_093814 3300042616 Bacteria 11617
135 Ga0466723_123771 3300042618 Bacteria 12843
136 Ga0466716_273156 3300042605 Bacteria 2347
137 Ga0466716_496543 3300042605 Bacteria 6762
138 Ga0466721_020669 3300042608 Bacteria 22937
139 Ga0102740_1000415 3300007140 Bacteria 11868
140 Ga0104048_1003424 3300007143 Bacteria 6661
141 Ga0123357_10001884 3300009784 Bacteria 22787
142 Ga0160469_102320 3300012824 Unclassified 3665
143 Ga0160441_101413 3300012825 Bacteria 7517
144 Ga0160472_100805 3300012839 Bacteria 13211
145 Ga0160434_100093 3300012850 Unclassified 53667
146 Ga0160457_1000618 3300012858 Bacteria 14156
147 Ga0466690_253941 3300042590 Bacteria 20390
148 Ga0466692_029952 3300042591 Bacteria 12294
149 Ga0466696_307874 3300042596 Bacteria 11381
150 Ga0466729_275172 3300042621 Bacteria 3577
151 Ga0466703_165518 3300042636 Bacteria 3579
152 Ga0466709_014514 3300042648 Bacteria 492815
153 Ga0466727_316709 3300042655 Bacteria 34486
154 Ga0466723_170348 3300042618 Bacteria 25045
155 Ga0466726_076133 3300042619 Bacteria 50177
156 Ga0466726_179462 3300042619 Bacteria 13389
157 Ga0466729_007879 3300042621 Bacteria 30241
158 Ga0466700_075647 3300042600 Bacteria 4018
159 Ga0123357_10043666 3300009784 Bacteria 6090
160 Ga0123353_10024007 3300010167 Bacteria 9245
161 Ga0123353_10344938 3300010167 Bacteria 2247
162 Ga0123353_10373409 3300010167 Bacteria 2137
163 IMNBL1DRAFT_c0003440 3300000062 Bacteria 10186
164 JGI24702J35022_10020945 3300002462 Bacteria 3549
165 Ga0466733_090983 3300042659 Bacteria 8051
166 Ga0160433_100435 3300012846 Unclassified 21612
167 Ga0466690_183666 3300042590 Bacteria 8816
168 Ga0466734_149994 3300042623 Bacteria 4128
169 Ga0466735_031351 3300042624 Bacteria 11211
170 Ga0466703_039792 3300042636 Bacteria 28795
171 Ga0466703_144705 3300042636 Bacteria 15009
172 Ga0466704_330242 3300042643 Bacteria 11401
173 Ga0466709_112853 3300042648 Bacteria 6092
174 Ga0466708_243982 3300042652 Bacteria 25514
175 Ga0466727_144932 3300042655 Bacteria 27909
176 Ga0466701_078688 3300042598 Bacteria 69881
177 Ga0466716_105623 3300042605 Bacteria 7048
178 Ga0466719_467287 3300042606 Bacteria 5727
179 Ga0466722_029449 3300042609 Bacteria 5785
180 Ga0123357_10012451 3300009784 Bacteria 10978
181 Ga0123353_10001040 3300010167 Bacteria 34017
182 Ga0123353_10010525 3300010167 Bacteria 12902
183 Ga0123354_10039269 3300010882 Bacteria 7340
184 2227514102 2225789004 Bacteria 3487
185 JGI24702J35022_10003166 3300002462 Bacteria 9954
186 JGI24702J35022_10005147 3300002462 Bacteria 7671
187 JGI24702J35022_10007219 3300002462 Bacteria 6385
188 JGI24702J35022_10031347 3300002462 Bacteria 2849
189 CVPL010W_10002027 3300002931 Bacteria 23856
190 Ga0104048_1001791 3300007143 Bacteria 4377
191 Ga0466697_271821 3300042611 Bacteria 3645
192 Ga0160443_100023 3300012848 Bacteria 403656
193 Ga0160430_100721 3300012852 Bacteria 15975
194 Ga0466657_025152 3300042582 Bacteria 4495
195 Ga0466692_165865 3300042591 Bacteria 23835
196 Ga0466691_189588 3300042593 Bacteria 38196
197 Ga0466695_285341 3300042595 Bacteria 15370
198 Ga0466696_057309 3300042596 Bacteria 8007
199 Ga0466709_214621 3300042648 Bacteria 11712
200 Ga0466708_053168 3300042652 Bacteria 12127
201 Ga0466727_042186 3300042655 Bacteria 4400
202 Ga0466711_244271 3300042615 Bacteria 4718
203 Ga0466715_244849 3300042616 Bacteria 30324
204 Ga0466715_423803 3300042616 Bacteria 5939
205 Ga0466718_159032 3300042617 Bacteria 1877
206 Ga0466707_072525 3300042601 Bacteria 13511
207 Ga0466707_208026 3300042601 Bacteria 3215
208 Ga0466713_095735 3300042602 Bacteria 6510
209 Ga0123357_10018649 3300009784 Bacteria 9230
210 Ga0123357_10094610 3300009784 Bacteria 3877
211 Ga0123355_10016100 3300009826 Bacteria 11773
212 Ga0123355_10018617 3300009826 Bacteria 11028
213 Ga0123353_10000028 3300010167 Bacteria 164820
214 Ga0123354_10000609 3300010882 Bacteria 37298
215 2227481315 2225789004 Bacteria 4425
216 2227502988 2225789004 Bacteria 3750
217 Ga0068305_10234432 3300005083 Bacteria 4781
218 Ga0102734_1001163 3300007129 Bacteria 6695

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820767225 2820768708 483
2 3300042597 Ga0466699_284338 Ga0466699_284338_45_1676 523
3 3300042648 Ga0466709_014514 Ga0466709_014514_242685_244358 530
4 3300042596 Ga0466696_486478 Ga0466696_486478_162_1766 534
5 3300042617 Ga0466718_159032 Ga0466718_159032_237_1844 535
6 3300042611 Ga0466697_113220 Ga0466697_113220_75_1700 541
7 3300042621 Ga0466729_215003 Ga0466729_215003_30_1655 541
8 3300042603 Ga0466714_084657 Ga0466714_084657_24_1652 542
9 3300010167 Ga0123353_10373409 Ga0123353_103734092 549
10 3300042603 Ga0466714_066823 Ga0466714_066823_127_1977 559
11 3300042582 Ga0466657_025152 Ga0466657_025152_177_1979 563
12 3300042592 Ga0466693_116857 Ga0466693_116857_247_1977 564
13 3300042591 Ga0466692_029952 Ga0466692_029952_4769_6574 566
14 3300012847 Ga0160445_100249 Ga0160445_10024923 568
15 3300010882 Ga0123354_10039269 Ga0123354_100392693 570
16 3300010882 Ga0123354_10000609 Ga0123354_1000060918 573
17 3300042598 Ga0466701_021511 Ga0466701_021511_5424_7223 575
18 3300009784 Ga0123357_10032404 Ga0123357_100324044 576
19 3300042582 Ga0466657_210485 Ga0466657_210485_7372_9165 576
20 3300002509 JGI24699J35502_11133640 JGI24699J35502_111336406 577
21 3300010167 Ga0123353_10024007 Ga0123353_100240075 577
22 3300042598 Ga0466701_094285 Ga0466701_094285_2077_3873 577
23 3300042616 Ga0466715_076767 Ga0466715_076767_1913_3709 577
24 3300042623 Ga0466734_149994 Ga0466734_149994_1901_3694 577
25 3300042648 Ga0466709_214621 Ga0466709_214621_6360_8093 577
26 2225789004 2227514102 2228011305 578
27 3300042625 Ga0466730_054806 Ga0466730_054806_599021_600820 578
28 3300009784 Ga0123357_10248477 Ga0123357_102484771 579
29 3300042598 Ga0466701_055658 Ga0466701_055658_33906_35702 581
30 3300042601 Ga0466707_072525 Ga0466707_072525_3565_5367 582
31 3300042621 Ga0466729_223968 Ga0466729_223968_401_2212 582
32 3300042636 Ga0466703_039792 Ga0466703_039792_9935_11746 582
33 3300042652 Ga0466708_243982 Ga0466708_243982_3100_4914 582
34 3300042655 Ga0466727_045994 Ga0466727_045994_101_1903 582
35 3300042618 Ga0466723_051232 Ga0466723_051232_1435_3237 583
36 3300042621 Ga0466729_275172 Ga0466729_275172_1126_2931 583
37 3300042649 Ga0466724_02195 Ga0466724_02195_1005_2819 583
38 3300009784 Ga0123357_10001884 Ga0123357_100018841 584
39 3300042643 Ga0466704_577848 Ga0466704_577848_3250_5058 584
40 3300042659 Ga0466733_028910 Ga0466733_028910_174_1982 584
41 3300005083 Ga0068305_10234432 Ga0068305_102344326 585
42 3300042619 Ga0466726_436531 Ga0466726_436531_574_2352 585
43 3300042620 Ga0466728_430369 Ga0466728_430369_6289_8070 585
44 3300005083 Ga0068305_10182627 Ga0068305_101826272 586
45 3300042600 Ga0466700_119831 Ga0466700_119831_13850_15643 586
46 3300042605 Ga0466716_273156 Ga0466716_273156_395_2182 586
47 3300042643 Ga0466704_053113 Ga0466704_053113_9345_11168 586
48 3300042656 Ga0466732_277433 Ga0466732_277433_28437_30245 586
49 3300002462 JGI24702J35022_10003984 JGI24702J35022_100039847 587
50 3300042602 Ga0466713_007433 Ga0466713_007433_2903_4696 587
51 3300042611 Ga0466697_271821 Ga0466697_271821_972_2765 587
52 3300042615 Ga0466711_120138 Ga0466711_120138_241_2079 587
53 3300009784 Ga0123357_10001874 Ga0123357_100018741 588
54 3300042590 Ga0466690_006457 Ga0466690_006457_846_2654 588
55 3300042600 Ga0466700_075647 Ga0466700_075647_443_2233 588
56 3300009784 Ga0123357_10000678 Ga0123357_1000067826 589
57 3300042636 Ga0466703_144705 Ga0466703_144705_3913_5760 589
58 3300042596 Ga0466696_049113 Ga0466696_049113_33569_35389 590
59 3300042636 Ga0466703_204119 Ga0466703_204119_2921_4750 590
60 3300042643 Ga0466704_460153 Ga0466704_460153_2258_4084 590
61 3300042591 Ga0466692_073863 Ga0466692_073863_20266_22041 591
62 3300042619 Ga0466726_428257 Ga0466726_428257_201_2018 591
63 3300042655 Ga0466727_316709 Ga0466727_316709_29956_31758 591
64 3300042593 Ga0466691_018749 Ga0466691_018749_3435_5228 592
65 3300042591 Ga0466692_168038 Ga0466692_168038_586_2385 593
66 3300042615 Ga0466711_070021 Ga0466711_070021_2487_4268 593
67 3300000062 IMNBL1DRAFT_c0010343 IMNBL1DRAFT_00103435 594
68 iso_pr_bacteria 2820746860 2820747786 594
69 3300009784 Ga0123357_10037303 Ga0123357_100373034 595
70 3300010167 Ga0123353_10344938 Ga0123353_103449381 595
71 3300042598 Ga0466701_078688 Ga0466701_078688_29278_31068 596
72 3300042605 Ga0466716_175246 Ga0466716_175246_17880_19670 596
73 3300042611 Ga0466697_096879 Ga0466697_096879_270081_271871 596
74 3300042613 Ga0466710_174404 Ga0466710_174404_1471_3261 596
75 iso_pr_bacteria 2820748953 2820750105 596
76 iso_pr_bacteria 2820767225 2820767450 596
77 3300002504 JGI24705J35276_12238036 JGI24705J35276_122380366 597
78 3300002509 JGI24699J35502_11134138 JGI24699J35502_1113413819 597
79 3300007085 Ga0104045_1005542 Ga0104045_10055422 597
80 3300010167 Ga0123353_10074106 Ga0123353_100741061 597
81 3300012837 Ga0160455_100105 Ga0160455_10010526 597
82 3300012846 Ga0160433_100012 Ga0160433_100012205 597
83 3300042609 Ga0466722_029449 Ga0466722_029449_3572_5365 597
84 3300042613 Ga0466710_392961 Ga0466710_392961_1002_2795 597
85 3300042621 Ga0466729_007879 Ga0466729_007879_17162_18955 597
86 iso_pr_bacteria 2820759988 2820760716 597
87 3300002462 JGI24702J35022_10007219 JGI24702J35022_100072194 598
88 3300002931 CVPL010W_10002027 CVPL010W_1000202717 598
89 3300007143 Ga0104048_1001791 Ga0104048_10017912 598
90 3300009784 Ga0123357_10001340 Ga0123357_1000134024 598
91 3300009784 Ga0123357_10012451 Ga0123357_100124517 598
92 3300009784 Ga0123357_10018649 Ga0123357_100186497 598
93 3300009784 Ga0123357_10043666 Ga0123357_100436664 598
94 3300010167 Ga0123353_10001040 Ga0123353_100010407 598
95 3300010882 Ga0123354_10000186 Ga0123354_1000018626 598
96 3300012848 Ga0160443_100023 Ga0160443_100023171 598
97 3300042590 Ga0466690_253941 Ga0466690_253941_16412_18208 598
98 3300042593 Ga0466691_189588 Ga0466691_189588_9294_11090 598
99 3300042596 Ga0466696_307874 Ga0466696_307874_5918_7714 598
100 3300042598 Ga0466701_052765 Ga0466701_052765_91242_93038 598
101 3300042615 Ga0466711_244271 Ga0466711_244271_244_2055 598
102 3300042619 Ga0466726_076133 Ga0466726_076133_19850_21646 598
103 3300042649 Ga0466724_28891 Ga0466724_28891_126320_128116 598
104 3300042655 Ga0466727_144932 Ga0466727_144932_7066_8862 598
105 3300042655 Ga0466727_261708 Ga0466727_261708_270_2090 598
106 iso_pr_bacteria 2820785563 2820786885 598
107 iso_pr_bacteria 2899132286 2899132414 598
108 3300007143 Ga0104048_1003424 Ga0104048_10034242 599
109 3300009826 Ga0123355_10016100 Ga0123355_100161005 599
110 3300009826 Ga0123355_10018617 Ga0123355_1001861710 599
111 3300010049 Ga0123356_10005286 Ga0123356_100052862 599
112 3300010167 Ga0123353_10010525 Ga0123353_100105257 599
113 3300012858 Ga0160457_1000618 Ga0160457_10006187 599
114 3300042590 Ga0466690_183666 Ga0466690_183666_562_2361 599
115 3300042590 Ga0466690_322261 Ga0466690_322261_11078_12877 599
116 3300042593 Ga0466691_095154 Ga0466691_095154_5335_7134 599
117 3300042595 Ga0466695_285341 Ga0466695_285341_681_2480 599
118 3300042602 Ga0466713_095735 Ga0466713_095735_4445_6244 599
119 3300042602 Ga0466713_124887 Ga0466713_124887_8237_10036 599
120 3300042602 Ga0466713_156423 Ga0466713_156423_1042_2841 599
121 3300042612 Ga0466705_056487 Ga0466705_056487_3574_5373 599
122 3300042613 Ga0466710_423219 Ga0466710_423219_65_1864 599
123 3300042616 Ga0466715_093814 Ga0466715_093814_5452_7251 599
124 3300042624 Ga0466735_194728 Ga0466735_194728_246_2045 599
125 iso_pr_bacteria 2590828803 2592927563 599
126 iso_pr_bacteria 2820770630 2820770718 599
127 3300002462 JGI24702J35022_10003166 JGI24702J35022_100031667 600
128 3300002462 JGI24702J35022_10031347 JGI24702J35022_100313473 600
129 3300005071 Ga0068302_10101704 Ga0068302_101017043 600
130 3300010167 Ga0123353_10000028 Ga0123353_1000002888 600
131 3300012825 Ga0160441_101413 Ga0160441_1014134 600
132 3300042596 Ga0466696_225169 Ga0466696_225169_23275_25077 600
133 3300042606 Ga0466719_326107 Ga0466719_326107_100_1902 600
134 3300042612 Ga0466705_325670 Ga0466705_325670_234_2036 600
135 3300042624 Ga0466735_031351 Ga0466735_031351_1636_3438 600
136 3300042636 Ga0466703_091103 Ga0466703_091103_242_2044 600
137 3300042636 Ga0466703_165518 Ga0466703_165518_835_2637 600
138 3300042643 Ga0466704_307788 Ga0466704_307788_9450_11252 600
139 3300042648 Ga0466709_233448 Ga0466709_233448_22964_24766 600
140 3300056842 Ga0562377_0004 Ga0562377_0004_2993994_2995796 600
141 iso_pr_bacteria 2820762746 2820763906 600
142 iso_pr_bacteria 2940244548 2940247860 600
143 iso_pr_bacteria 2940248789 2940252154 600
144 iso_pr_bacteria 2940253009 2940256377 600
145 iso_pr_bacteria 2940257232 2940260483 600
146 3300000062 IMNBL1DRAFT_c0003440 IMNBL1DRAFT_00034404 601
147 3300002462 JGI24702J35022_10020945 JGI24702J35022_100209452 601
148 3300002462 JGI24702J35022_10043892 JGI24702J35022_100438922 601
149 3300002509 JGI24699J35502_11134056 JGI24699J35502_1113405621 601
150 3300012803 Ga0160465_100020 Ga0160465_10002020 601
151 3300012839 Ga0160472_100805 Ga0160472_1008053 601
152 3300012850 Ga0160434_100093 Ga0160434_10009321 601
153 3300012857 Ga0160435_1000114 Ga0160435_100011445 601
154 3300042591 Ga0466692_165865 Ga0466692_165865_20920_22725 601
155 3300042593 Ga0466691_031423 Ga0466691_031423_298_2103 601
156 3300042602 Ga0466713_096596 Ga0466713_096596_19600_21405 601
157 3300042605 Ga0466716_105623 Ga0466716_105623_650_2455 601
158 3300042616 Ga0466715_423803 Ga0466715_423803_1081_2886 601
159 3300042636 Ga0466703_135121 Ga0466703_135121_1155_2960 601
160 3300042636 Ga0466703_158987 Ga0466703_158987_1160_2965 601
161 3300042652 Ga0466708_283752 Ga0466708_283752_413_2218 601
162 iso_pr_bacteria 2820772500 2820772771 601
163 iso_pr_bacteria 2820789850 2820791306 601
164 2225789004 2227477413 2227931567 602
165 2225789004 2227481315 2227942076 602
166 2225789004 2227507947 2227997972 602
167 3300007129 Ga0102734_1001163 Ga0102734_10011638 602
168 3300010167 Ga0123353_10103210 Ga0123353_101032104 602
169 3300012803 Ga0160465_100010 Ga0160465_1000108 602
170 3300012852 Ga0160430_100721 Ga0160430_10072110 602
171 3300042590 Ga0466690_018936 Ga0466690_018936_3102_4910 602
172 3300042590 Ga0466690_378263 Ga0466690_378263_15345_17153 602
173 3300042596 Ga0466696_057309 Ga0466696_057309_5243_7051 602
174 3300042600 Ga0466700_282668 Ga0466700_282668_788_2596 602
175 3300042602 Ga0466713_096507 Ga0466713_096507_13089_14897 602
176 3300042605 Ga0466716_496543 Ga0466716_496543_2773_4581 602
177 3300042615 Ga0466711_032287 Ga0466711_032287_5783_7591 602
178 3300042618 Ga0466723_123771 Ga0466723_123771_7943_9751 602
179 3300042619 Ga0466726_179462 Ga0466726_179462_9003_10811 602
180 3300042624 Ga0466735_128327 Ga0466735_128327_384_2192 602
181 3300042648 Ga0466709_112853 Ga0466709_112853_767_2575 602
182 3300042652 Ga0466708_053168 Ga0466708_053168_9859_11667 602
183 3300042659 Ga0466733_090983 Ga0466733_090983_121_1929 602
184 iso_pr_bacteria 2820744581 2820745105 602
185 3300000062 IMNBL1DRAFT_c0000785 IMNBL1DRAFT_000078523 603
186 3300000062 IMNBL1DRAFT_c0002721 IMNBL1DRAFT_00027213 603
187 3300002462 JGI24702J35022_10005147 JGI24702J35022_100051478 603
188 3300002504 JGI24705J35276_12223922 JGI24705J35276_122239221 603
189 3300012824 Ga0160469_102320 Ga0160469_1023202 603
190 3300012846 Ga0160433_100435 Ga0160433_10043510 603
191 3300042601 Ga0466707_208026 Ga0466707_208026_1338_3149 603
192 3300042606 Ga0466719_467287 Ga0466719_467287_2561_4372 603
193 3300042608 Ga0466721_020669 Ga0466721_020669_16022_17833 603
194 3300042616 Ga0466715_368883 Ga0466715_368883_1832_3643 603
195 3300042618 Ga0466723_023375 Ga0466723_023375_8137_9948 603
196 3300042619 Ga0466726_234425 Ga0466726_234425_2909_4720 603
197 3300042624 Ga0466735_186532 Ga0466735_186532_755_2566 603
198 3300042659 Ga0466733_155754 Ga0466733_155754_848_2659 603
199 iso_pr_bacteria 2940216256 2940217132 603
200 3300042598 Ga0466701_000462 Ga0466701_000462_26537_28351 604
201 3300042609 Ga0466722_227168 Ga0466722_227168_12_1826 604
202 3300042618 Ga0466723_170348 Ga0466723_170348_4228_6042 604
203 iso_pr_bacteria 2873600114 2873601542 604
204 iso_pr_bacteria 2873610414 2873611895 604
205 iso_pr_bacteria 8100157865 8100159363 604
206 3300012824 Ga0160469_100013 Ga0160469_100013270 605
207 3300042616 Ga0466715_159345 Ga0466715_159345_10226_12043 605
208 3300042616 Ga0466715_358257 Ga0466715_358257_18531_20348 605
209 3300042636 Ga0466703_305891 Ga0466703_305891_1117_2934 605
210 3300042655 Ga0466727_042186 Ga0466727_042186_1383_3200 605
211 3300009784 Ga0123357_10000085 Ga0123357_1000008542 606
212 3300012846 Ga0160433_101849 Ga0160433_1018494 606
213 3300012847 Ga0160445_100591 Ga0160445_10059115 606
214 3300042601 Ga0466707_136654 Ga0466707_136654_3918_5738 606
215 iso_pr_bacteria 2820778767 2820778903 606
216 3300010049 Ga0123356_10020734 Ga0123356_100207348 607
217 3300042601 Ga0466707_144321 Ga0466707_144321_11434_13257 607
218 3300042602 Ga0466713_143771 Ga0466713_143771_1406_3229 607
219 3300042606 Ga0466719_567749 Ga0466719_567749_556_2379 607
220 iso_pr_bacteria 2910930387 2910931938 607
221 3300012837 Ga0160455_100016 Ga0160455_10001669 608
222 3300042602 Ga0466713_000880 Ga0466713_000880_16211_18037 608
223 3300042612 Ga0466705_043883 Ga0466705_043883_36586_38412 608
224 3300042636 Ga0466703_045010 Ga0466703_045010_2117_3943 608
225 3300042643 Ga0466704_330242 Ga0466704_330242_5075_6901 608
226 3300009784 Ga0123357_10094610 Ga0123357_100946103 609
227 3300010882 Ga0123354_10078104 Ga0123354_100781044 609
228 3300012832 Ga0160458_100109 Ga0160458_10010951 609
229 3300042624 Ga0466735_055931 Ga0466735_055931_3052_4881 609
230 3300007140 Ga0102740_1000415 Ga0102740_10004155 610
231 iso_pr_bacteria 2910942425 2910946564 611
232 2225789004 2227502988 2227987832 612
233 3300012845 Ga0160460_100013 Ga0160460_100013123 612
234 3300042615 Ga0466711_403972 Ga0466711_403972_53084_55042 612
235 3300042621 Ga0466729_208225 Ga0466729_208225_1583_3421 612
236 3300042659 Ga0466733_150639 Ga0466733_150639_103794_105632 612
237 3300042601 Ga0466707_221537 Ga0466707_221537_1649_3490 613
238 3300042593 Ga0466691_005260 Ga0466691_005260_4737_6581 614
239 3300042601 Ga0466707_187402 Ga0466707_187402_20575_22419 614
240 3300042616 Ga0466715_244849 Ga0466715_244849_24870_26714 614
241 3300042590 Ga0466690_090432 Ga0466690_090432_1338_3230 630
242 3300042591 Ga0466692_168759 Ga0466692_168759_3469_5409 646

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08459 UvrC_RNaseH_dom UvrC RNAse H endonuclease domain 428 579 0.98
PF01541 GIY-YIG GIY-YIG catalytic domain 65 140 0.94
PF14520 HHH_5 Helix-hairpin-helix domain 593 639 0.94
PF22920 UvrC_RNaseH UvrC Ribonuclease H-like domain 303 402 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08459 GO:0009381 excinuclease ABC activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.51 0.53 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.