Protein Family IF04710

Metagenome Isolate
184 Members
90 Samples
149 Scaffolds
387.91 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_165042|Ga0466692_165042_609_1868
Length
419 aa
Sequence
MNKMNNNHSTVIAKAEPEAIRRKQYEIHLMNKVQVLYAGCLLLVAMNMAAQEEKSSLNPIYTGVPSLTIAPDARGGSMGDVGVATSPDMVSQYWNPAKLPFAWSKAGVQLSYTPWLRKLVSDIDLAYLSGYYKIGSEDNQAVGASIRYFSLGEVHLQETVDDIGMNINPYEMALDVSYSVKLTENFAGAVAFRYIRSDLGAGVVAGTDVGNAYAADVAGYYNKYVVAGSNECLLGLGFNISNIGTKISYNGGSISHFLPTNLRLGASYLMPLDDYNTLSLSLDLNKYLVPTPPDTRDIEDQVEKQRIEDEYKSISPITGIFKSFGDAPGGMKEELQEIMWSAGAEYAYNNQFFVRGGYFYEHPNKGNRQYFSLGAGFRMNVLQLDVAYLVATAASNPLDQTLRFSLTFDMDGLKGLLNR

📊 Sample Types

Isolate 19.0%
Metagenome 81.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 26.7%
Termitidae 16.7%
Kalotermitidae 15.6%
Unclassified 10.0%
Formicidae 7.8%
Rhinotermitidae 5.6%
Drosophilidae 3.3%
Passalidae 3.3%
Termopsidae 3.3%
Armadillidiidae 2.2%
Hydrophilidae 2.2%
Hodotermitidae 1.1%
Apidae 1.1%
Tenebrionidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 179
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
2 2923982719 Parabacteroides sp. 52 Isolate Blattidae
3 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
4 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
5 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
6 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
7 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
8 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
9 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
15 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
20 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
21 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
22 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
23 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
24 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
25 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
26 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
27 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
28 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
29 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
38 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
39 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
40 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
41 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
42 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
45 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
46 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
47 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
48 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
49 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
50 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
51 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
52 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
53 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
54 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
55 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
56 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
57 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
58 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
59 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
60 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
61 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
62 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
63 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
64 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
65 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
66 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
67 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
68 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
69 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
70 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
71 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
72 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
73 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
74 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
75 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
76 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
77 3004677695 Bacteroides sp. 214 Isolate Blattidae
78 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
79 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
80 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
81 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
82 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
83 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
84 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
85 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
86 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
87 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
88 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
89 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
90 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_055799 3300042659 Bacteria 106016
2 Ga0123353_10288115 3300010167 Bacteria 2516
3 IMNBL1DRAFT_c0001009 3300000062 Bacteria 21721
4 JGI24702J35022_10000743 3300002462 Bacteria 20084
5 JGI24702J35022_10069910 3300002462 Bacteria 1889
6 JGI24699J35502_11134185 3300002509 Bacteria 47737
7 Ga0104045_1003639 3300007085 Bacteria 1920
8 Ga0104050_1026167 3300007153 Bacteria 6347
9 Ga0466706_074360 3300042599 Bacteria 8175
10 Ga0466706_160405 3300042599 Bacteria 9242
11 Ga0466707_065166 3300042601 Bacteria 2502
12 Ga0466722_005250 3300042609 Bacteria 14032
13 Ga0466722_196515 3300042609 Bacteria 1836
14 Ga0466697_011496 3300042611 Bacteria 51969
15 Ga0466690_211147 3300042590 Bacteria 29487
16 Ga0466696_097884 3300042596 Bacteria 16155
17 Ga0466715_161968 3300042616 Bacteria 8358
18 Ga0466735_114704 3300042624 Bacteria 2421
19 Ga0466704_055817 3300042643 Bacteria 8022
20 Ga0466704_251609 3300042643 Bacteria 45182
21 Ga0466727_318309 3300042655 Bacteria 3857
22 Ga0466705_233444 3300042612 Bacteria 9951
23 Ga0104048_1170946 3300007143 Bacteria 1578
24 Ga0466707_161645 3300042601 Bacteria 28036
25 Ga0466713_011019 3300042602 Bacteria 19476
26 Ga0466716_103220 3300042605 Bacteria 15494
27 Ga0466716_216072 3300042605 Bacteria 7141
28 Ga0466719_413201 3300042606 Bacteria 2918
29 Ga0466657_087994 3300042582 Unclassified 3196
30 Ga0466657_136010 3300042582 Bacteria 11968
31 Ga0466690_038698 3300042590 Bacteria 19777
32 Ga0466692_165042 3300042591 Bacteria 3646
33 Ga0466696_157636 3300042596 Bacteria 2773
34 Ga0466710_292942 3300042613 Bacteria 2526
35 Ga0466710_337619 3300042613 Bacteria 6084
36 Ga0466711_072455 3300042615 Bacteria 67585
37 Ga0466711_324855 3300042615 Bacteria 13815
38 Ga0466711_371290 3300042615 Bacteria 10082
39 Ga0466726_048125 3300042619 Bacteria 3369
40 Ga0466728_360011 3300042620 Bacteria 10825
41 Ga0466735_205875 3300042624 Bacteria 2596
42 Ga0466703_075697 3300042636 Bacteria 9217
43 Ga0466704_125322 3300042643 Bacteria 12471
44 Ga0466709_363785 3300042648 Bacteria 41688
45 Ga0562377_0004 3300056842 Bacteria 3525959
46 Ga0103265_1000672 3300007068 Bacteria 5731
47 Ga0102737_1000070 3300007142 Bacteria 41738
48 Ga0466707_095132 3300042601 Bacteria 7364
49 Ga0466692_150345 3300042591 Bacteria 15119
50 Ga0466696_265818 3300042596 Bacteria 2379
51 Ga0466711_201488 3300042615 Bacteria 18778
52 Ga0466711_252475 3300042615 Bacteria 2845
53 Ga0466715_106437 3300042616 Bacteria 8386
54 Ga0466729_190476 3300042621 Bacteria 6078
55 Ga0466729_219568 3300042621 Bacteria 6131
56 Ga0466735_076805 3300042624 Bacteria 1849
57 Ga0466735_211515 3300042624 Bacteria 3083
58 Ga0466704_282969 3300042643 Bacteria 8623
59 2227008130 2225789003 Bacteria 29189
60 2227582948 2225789004 Bacteria 13326
61 IMNBL1DRAFT_c0001178 3300000062 Bacteria 19919
62 Ga0123357_10000910 3300009784 Bacteria 30052
63 Ga0466701_017057 3300042598 Bacteria 176601
64 Ga0466713_056151 3300042602 Bacteria 40882
65 Ga0466713_116696 3300042602 Bacteria 4828
66 Ga0466722_087839 3300042609 Bacteria 11186
67 Ga0466722_092954 3300042609 Bacteria 48543
68 Ga0466656_378056 3300042550 Bacteria 2564
69 Ga0466696_049250 3300042596 Bacteria 2670
70 Ga0466705_399227 3300042612 Bacteria 3810
71 Ga0466728_229381 3300042620 Bacteria 18640
72 Ga0466735_059852 3300042624 Bacteria 8124
73 Ga0466703_165459 3300042636 Bacteria 12745
74 Ga0466704_297287 3300042643 Bacteria 3007
75 Ga0466709_138735 3300042648 Bacteria 8245
76 Ga0123354_10114610 3300010882 Bacteria 3529
77 2227327997 2225789004 Bacteria 6360
78 JGI24702J35022_10010203 3300002462 Bacteria 5259
79 JGI24702J35022_10033381 3300002462 Bacteria 2753
80 JGI24699J35502_11133779 3300002509 Bacteria 15459
81 CVPL010W_10007653 3300002931 Bacteria 10527
82 Ga0466706_059455 3300042599 Bacteria 7609
83 Ga0466713_059975 3300042602 Bacteria 22865
84 Ga0466690_246577 3300042590 Bacteria 16883
85 Ga0466691_148747 3300042593 Bacteria 15449
86 Ga0466695_080367 3300042595 Bacteria 3025
87 Ga0466711_171358 3300042615 Bacteria 5581
88 Ga0466715_583205 3300042616 Bacteria 24186
89 Ga0466728_300361 3300042620 Bacteria 29412
90 Ga0466703_202703 3300042636 Bacteria 8925
91 Ga0466704_494803 3300042643 Bacteria 2830
92 2227258581 2225789004 Bacteria 7027
93 IMNBL1DRAFT_c0003460 3300000062 Bacteria 10134
94 JGI24702J35022_10000410 3300002462 Bacteria 25605
95 Ga0068305_10032376 3300005083 Bacteria 3933
96 Ga0466713_034436 3300042602 Bacteria 12185
97 Ga0466722_055456 3300042609 Bacteria 2608
98 Ga0160455_100143 3300012837 Bacteria 88256
99 Ga0160433_100102 3300012846 Bacteria 86318
100 Ga0466696_054708 3300042596 Bacteria 19377
101 Ga0466711_273604 3300042615 Bacteria 21348
102 Ga0466715_040385 3300042616 Bacteria 43736
103 Ga0466723_089568 3300042618 Bacteria 54083
104 Ga0466728_188456 3300042620 Bacteria 11482
105 Ga0466728_204044 3300042620 Bacteria 20525
106 Ga0466733_165958 3300042659 Bacteria 2650
107 IMNBL1DRAFT_c0000733 3300000062 Bacteria 26035
108 JGI24705J35276_12238673 3300002504 Bacteria 35524
109 Ga0102735_1000440 3300007080 Bacteria 8936
110 Ga0103268_1000703 3300007192 Unclassified 9598
111 Ga0466707_016891 3300042601 Bacteria 35922
112 Ga0466719_457528 3300042606 Bacteria 7994
113 Ga0466692_176669 3300042591 Bacteria 77723
114 Ga0466691_122501 3300042593 Bacteria 7158
115 Ga0466691_183257 3300042593 Bacteria 2125
116 Ga0466696_003743 3300042596 Bacteria 8451
117 Ga0466715_290868 3300042616 Bacteria 7967
118 Ga0466715_625525 3300042616 Unclassified 7456
119 Ga0466703_064726 3300042636 Bacteria 3748
120 Ga0466703_314103 3300042636 Bacteria 9653
121 Ga0466708_046243 3300042652 Bacteria 10646
122 Ga0123357_10138704 3300009784 Bacteria 2997
123 Ga0123356_10027402 3300010049 Bacteria 5340
124 IMNBL1DRAFT_c0001920 3300000062 Bacteria 15041
125 Ga0068305_10007404 3300005083 Bacteria 89340
126 Ga0102734_1000260 3300007129 Unclassified 16440
127 Ga0102740_1000787 3300007140 Unclassified 9039
128 Ga0466706_050698 3300042599 Bacteria 48334
129 Ga0466706_247853 3300042599 Bacteria 2284
130 Ga0466713_035424 3300042602 Bacteria 10259
131 Ga0466713_107765 3300042602 Bacteria 14668
132 Ga0466716_174387 3300042605 Bacteria 24121
133 Ga0466716_280211 3300042605 Bacteria 5823
134 Ga0466716_357046 3300042605 Bacteria 8030
135 Ga0466722_032322 3300042609 Bacteria 11017
136 Ga0466722_249809 3300042609 Bacteria 7232
137 Ga0466692_172707 3300042591 Bacteria 15335
138 Ga0466696_114042 3300042596 Bacteria 8252
139 Ga0466696_162075 3300042596 Bacteria 29425
140 Ga0466715_017736 3300042616 Bacteria 12115
141 Ga0466715_166813 3300042616 Bacteria 19403
142 Ga0466715_509861 3300042616 Bacteria 18242
143 Ga0466726_070124 3300042619 Bacteria 2802
144 Ga0466728_327607 3300042620 Bacteria 29712
145 Ga0466729_060358 3300042621 Bacteria 13859
146 Ga0466703_291687 3300042636 Bacteria 9949
147 Ga0466704_477462 3300042643 Bacteria 10469
148 Ga0466724_24871 3300042649 Bacteria 3437
149 Ga0466708_095257 3300042652 Bacteria 18757

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012837 Ga0160455_100143 Ga0160455_10014328 331
2 3300042593 Ga0466691_148747 Ga0466691_148747_8555_9586 343
3 3300042616 Ga0466715_166813 Ga0466715_166813_2026_3171 359
4 3300042616 Ga0466715_625525 Ga0466715_625525_3611_4735 359
5 3300042596 Ga0466696_114042 Ga0466696_114042_5145_6248 360
6 3300042616 Ga0466715_290868 Ga0466715_290868_4115_5263 367
7 3300002462 JGI24702J35022_10000743 JGI24702J35022_100007438 371
8 3300042620 Ga0466728_300361 Ga0466728_300361_16342_17517 371
9 3300042652 Ga0466708_095257 Ga0466708_095257_1077_2192 371
10 3300042602 Ga0466713_059975 Ga0466713_059975_11528_12691 372
11 3300042616 Ga0466715_161968 Ga0466715_161968_2931_4094 372
12 3300042648 Ga0466709_363785 Ga0466709_363785_12052_13215 372
13 3300007142 Ga0102737_1000070 Ga0102737_100007016 373
14 3300042596 Ga0466696_097884 Ga0466696_097884_5953_7137 374
15 3300042605 Ga0466716_357046 Ga0466716_357046_1468_2592 374
16 3300042621 Ga0466729_190476 Ga0466729_190476_4222_5370 374
17 3300012846 Ga0160433_100102 Ga0160433_10010253 375
18 3300042596 Ga0466696_054708 Ga0466696_054708_1812_2939 375
19 3300042596 Ga0466696_265818 Ga0466696_265818_811_1938 375
20 3300007129 Ga0102734_1000260 Ga0102734_10002609 376
21 3300042636 Ga0466703_075697 Ga0466703_075697_3037_4170 377
22 3300010882 Ga0123354_10114610 Ga0123354_101146102 378
23 3300042599 Ga0466706_050698 Ga0466706_050698_20392_21561 378
24 3300042615 Ga0466711_324855 Ga0466711_324855_613_1749 378
25 3300042636 Ga0466703_291687 Ga0466703_291687_6973_8136 378
26 3300042595 Ga0466695_080367 Ga0466695_080367_1613_2752 379
27 3300042612 Ga0466705_399227 Ga0466705_399227_1696_2835 379
28 3300042616 Ga0466715_509861 Ga0466715_509861_11486_12625 379
29 3300042643 Ga0466704_297287 Ga0466704_297287_1812_2951 379
30 3300042649 Ga0466724_24871 Ga0466724_24871_1318_2508 379
31 3300042596 Ga0466696_049250 Ga0466696_049250_967_2109 380
32 3300042598 Ga0466701_017057 Ga0466701_017057_152223_153365 380
33 3300042599 Ga0466706_160405 Ga0466706_160405_4133_5275 380
34 3300042605 Ga0466716_174387 Ga0466716_174387_10135_11277 380
35 3300007085 Ga0104045_1003639 Ga0104045_10036392 381
36 3300007143 Ga0104048_1170946 Ga0104048_11709462 381
37 3300007153 Ga0104050_1026167 Ga0104050_10261673 381
38 3300007192 Ga0103268_1000703 Ga0103268_10007037 381
39 3300042636 Ga0466703_165459 Ga0466703_165459_9476_10651 381
40 3300042550 Ga0466656_378056 Ga0466656_378056_1169_2335 382
41 3300042609 Ga0466722_032322 Ga0466722_032322_8799_9947 382
42 3300042616 Ga0466715_583205 Ga0466715_583205_10757_11905 382
43 3300042582 Ga0466657_136010 Ga0466657_136010_914_2065 383
44 3300042602 Ga0466713_011019 Ga0466713_011019_5300_6451 383
45 3300042606 Ga0466719_457528 Ga0466719_457528_1408_2559 383
46 3300042611 Ga0466697_011496 Ga0466697_011496_29391_30542 383
47 3300042643 Ga0466704_477462 Ga0466704_477462_5823_6974 383
48 3300005083 Ga0068305_10032376 Ga0068305_100323762 384
49 3300042582 Ga0466657_087994 Ga0466657_087994_1707_2861 384
50 3300042593 Ga0466691_183257 Ga0466691_183257_644_1798 384
51 3300042616 Ga0466715_017736 Ga0466715_017736_1567_2742 384
52 3300042618 Ga0466723_089568 Ga0466723_089568_36003_37157 384
53 3300042616 Ga0466715_040385 Ga0466715_040385_36108_37265 385
54 3300042616 Ga0466715_106437 Ga0466715_106437_6501_7694 385
55 3300002931 CVPL010W_10007653 CVPL010W_100076535 386
56 3300007068 Ga0103265_1000672 Ga0103265_10006725 386
57 3300007080 Ga0102735_1000440 Ga0102735_10004406 386
58 3300007140 Ga0102740_1000787 Ga0102740_10007877 386
59 3300042602 Ga0466713_116696 Ga0466713_116696_1188_2348 386
60 3300042609 Ga0466722_005250 Ga0466722_005250_12681_13910 386
61 3300042615 Ga0466711_201488 Ga0466711_201488_11590_12750 386
62 3300042620 Ga0466728_360011 Ga0466728_360011_5919_7094 386
63 3300042624 Ga0466735_205875 Ga0466735_205875_1177_2337 386
64 3300042590 Ga0466690_211147 Ga0466690_211147_22447_23646 387
65 3300042596 Ga0466696_162075 Ga0466696_162075_13687_14850 387
66 3300042601 Ga0466707_016891 Ga0466707_016891_24537_25700 387
67 3300042621 Ga0466729_060358 Ga0466729_060358_6019_7218 387
68 3300042621 Ga0466729_219568 Ga0466729_219568_4338_5501 387
69 iso_pr_bacteria 2820757377 2820759216 387
70 iso_pr_bacteria 2910949487 2910949876 387
71 iso_pr_bacteria 8100166142 8100170086 387
72 2225789003 2227008130 2227364905 388
73 2225789004 2227327997 2227775609 388
74 3300002509 JGI24699J35502_11134185 JGI24699J35502_1113418521 388
75 3300042599 Ga0466706_247853 Ga0466706_247853_213_1379 388
76 3300042612 Ga0466705_233444 Ga0466705_233444_1791_2957 388
77 3300042636 Ga0466703_064726 Ga0466703_064726_1100_2266 388
78 3300042643 Ga0466704_125322 Ga0466704_125322_3582_4748 388
79 3300056842 Ga0562377_0004 Ga0562377_0004_1844868_1846034 388
80 iso_pr_bacteria 2695420317 2695486511 388
81 iso_pr_bacteria 2695420931 2698111639 388
82 iso_pr_bacteria 2873600114 2873603698 388
83 iso_pr_bacteria 2873610414 2873614140 388
84 iso_pr_bacteria 2910930387 2910931036 388
85 iso_pr_bacteria 3004677695 3004678905 388
86 iso_pr_bacteria 8100157865 8100160194 388
87 2225789004 2227582948 2228136108 389
88 3300000062 IMNBL1DRAFT_c0003460 IMNBL1DRAFT_00034609 389
89 3300042602 Ga0466713_035424 Ga0466713_035424_3736_4905 389
90 3300042613 Ga0466710_292942 Ga0466710_292942_122_1291 389
91 2225789004 2227258581 2227704062 390
92 3300000062 IMNBL1DRAFT_c0001009 IMNBL1DRAFT_000100911 390
93 3300002462 JGI24702J35022_10010203 JGI24702J35022_100102032 390
94 3300002462 JGI24702J35022_10033381 JGI24702J35022_100333811 390
95 3300002462 JGI24702J35022_10069910 JGI24702J35022_100699101 390
96 3300010049 Ga0123356_10027402 Ga0123356_100274022 390
97 3300042615 Ga0466711_171358 Ga0466711_171358_3481_4653 390
98 3300042619 Ga0466726_070124 Ga0466726_070124_1393_2565 390
99 3300042624 Ga0466735_059852 Ga0466735_059852_3059_4231 390
100 3300000062 IMNBL1DRAFT_c0000733 IMNBL1DRAFT_00007334 391
101 3300000062 IMNBL1DRAFT_c0001178 IMNBL1DRAFT_000117814 391
102 3300005083 Ga0068305_10007404 Ga0068305_1000740454 391
103 3300009784 Ga0123357_10138704 Ga0123357_101387042 391
104 3300042605 Ga0466716_280211 Ga0466716_280211_2142_3317 391
105 3300042609 Ga0466722_092954 Ga0466722_092954_42799_44064 391
106 3300042613 Ga0466710_337619 Ga0466710_337619_2544_3719 391
107 3300042620 Ga0466728_204044 Ga0466728_204044_14114_15289 391
108 3300042643 Ga0466704_282969 Ga0466704_282969_1940_3115 391
109 iso_pr_bacteria 2820762746 2820763220 391
110 iso_pr_bacteria 2940193328 2940193681 391
111 iso_pr_bacteria 2940336608 2940336960 391
112 3300002504 JGI24705J35276_12238673 JGI24705J35276_1223867313 392
113 3300002509 JGI24699J35502_11133779 JGI24699J35502_111337794 392
114 3300042591 Ga0466692_150345 Ga0466692_150345_12600_13778 392
115 3300042593 Ga0466691_122501 Ga0466691_122501_4699_5877 392
116 3300042596 Ga0466696_157636 Ga0466696_157636_1475_2653 392
117 3300042599 Ga0466706_059455 Ga0466706_059455_5693_6871 392
118 3300042602 Ga0466713_034436 Ga0466713_034436_3710_4888 392
119 3300042609 Ga0466722_196515 Ga0466722_196515_346_1524 392
120 3300042624 Ga0466735_114704 Ga0466735_114704_622_1800 392
121 iso_pr_bacteria 2940244548 2940246615 392
122 iso_pr_bacteria 2940248789 2940250809 392
123 iso_pr_bacteria 2940253009 2940254884 392
124 iso_pr_bacteria 2940257232 2940258933 392
125 3300042601 Ga0466707_095132 Ga0466707_095132_1734_2915 393
126 3300042602 Ga0466713_107765 Ga0466713_107765_10134_11315 393
127 3300042605 Ga0466716_103220 Ga0466716_103220_8301_9482 393
128 3300042609 Ga0466722_055456 Ga0466722_055456_1061_2242 393
129 3300042643 Ga0466704_251609 Ga0466704_251609_11025_12206 393
130 3300042659 Ga0466733_055799 Ga0466733_055799_60537_61718 393
131 3300042596 Ga0466696_003743 Ga0466696_003743_6496_7680 394
132 3300042606 Ga0466719_413201 Ga0466719_413201_1108_2292 394
133 3300042643 Ga0466704_494803 Ga0466704_494803_221_1405 394
134 3300042659 Ga0466733_165958 Ga0466733_165958_150_1334 394
135 iso_pr_bacteria 2940205530 2940209138 394
136 iso_pr_bacteria 2940212447 2940216080 394
137 iso_pr_bacteria 2940298504 2940302134 394
138 iso_pr_bacteria 2940302308 2940305908 394
139 iso_pr_bacteria 2940306115 2940309784 394
140 iso_pr_bacteria 2940309933 2940313569 394
141 iso_pr_bacteria 2940313741 2940317407 394
142 iso_pr_bacteria 2940317558 2940321248 394
143 iso_pr_bacteria 2940321370 2940325061 394
144 iso_pr_bacteria 2940325180 2940328778 394
145 iso_pr_bacteria 2940328985 2940332615 394
146 iso_pr_bacteria 2940332795 2940336458 394
147 3300042590 Ga0466690_246577 Ga0466690_246577_8111_9298 395
148 3300042620 Ga0466728_229381 Ga0466728_229381_5194_6381 395
149 3300042636 Ga0466703_202703 Ga0466703_202703_997_2184 395
150 3300042643 Ga0466704_055817 Ga0466704_055817_1694_2881 395
151 3300042652 Ga0466708_046243 Ga0466708_046243_998_2185 395
152 iso_pr_bacteria 2820778767 2820779635 395
153 3300009784 Ga0123357_10000910 Ga0123357_100009107 396
154 3300042605 Ga0466716_216072 Ga0466716_216072_663_1853 396
155 3300042609 Ga0466722_249809 Ga0466722_249809_1979_3169 396
156 3300042615 Ga0466711_273604 Ga0466711_273604_9914_11104 396
157 3300042619 Ga0466726_048125 Ga0466726_048125_1266_2456 396
158 3300042636 Ga0466703_314103 Ga0466703_314103_6203_7393 396
159 3300042590 Ga0466690_038698 Ga0466690_038698_5664_6857 397
160 3300042601 Ga0466707_065166 Ga0466707_065166_920_2113 397
161 3300042620 Ga0466728_327607 Ga0466728_327607_16683_17876 397
162 3300042655 Ga0466727_318309 Ga0466727_318309_1097_2290 397
163 iso_pr_bacteria 2695420314 2695472172 397
164 3300042591 Ga0466692_172707 Ga0466692_172707_8025_9221 398
165 3300042599 Ga0466706_074360 Ga0466706_074360_431_1627 398
166 3300042602 Ga0466713_056151 Ga0466713_056151_1857_3053 398
167 3300042615 Ga0466711_252475 Ga0466711_252475_1097_2293 398
168 iso_pr_bacteria 2923982719 2923983341 398
169 iso_pr_bacteria 2940371297 2940372637 398
170 3300010167 Ga0123353_10288115 Ga0123353_102881152 399
171 3300042591 Ga0466692_176669 Ga0466692_176669_48665_49864 399
172 3300042615 Ga0466711_072455 Ga0466711_072455_40148_41347 399
173 3300042615 Ga0466711_371290 Ga0466711_371290_5082_6281 399
174 3300042620 Ga0466728_188456 Ga0466728_188456_6762_7961 399
175 iso_pr_bacteria 2940195863 2940197162 399
176 3300000062 IMNBL1DRAFT_c0001920 IMNBL1DRAFT_000192010 400
177 3300042648 Ga0466709_138735 Ga0466709_138735_2968_4173 401
178 3300002462 JGI24702J35022_10000410 JGI24702J35022_1000041014 403
179 3300042624 Ga0466735_076805 Ga0466735_076805_511_1722 403
180 3300042609 Ga0466722_087839 Ga0466722_087839_2017_3231 404
181 3300042624 Ga0466735_211515 Ga0466735_211515_482_1696 404
182 iso_pr_bacteria 8065497608 8065498713 408
183 3300042601 Ga0466707_161645 Ga0466707_161645_6639_7874 411
184 3300042591 Ga0466692_165042 Ga0466692_165042_609_1868 419

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19572 PorV Type IX secretion system protein PorV 58 294 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.