Protein Family IF04704
Metagenome
Isolate
135
Members
51
Samples
128
Scaffolds
372.31
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_156027|Ga0466692_156027_77926_79287
- Length
- 453 aa
- Sequence
- MTGFSGVRLLTAKDKNQSIKHFSPGNSICTVQLFLFRIKSLKINIINHSQSIFLFGSYEKSVLLSWNKKLKSLDDSKVRMAGIYFHIPFCKTRCIYCDFFSSSCQDGKIEYVDTLCRELEERKNYLQEQTVNTIYFGGGSPSQLSAGDFERIFDRLFRLFNLNLEFFLHGKIEVTLEANPDDITPEYLNSIRYLPFNRISLGVQSFNDNELKFLNRRHDAQTAIRAVELCRKQGFENISIDLMYGLPGQRLEIWEENIRQAILLNVQHLSAYHLIYEEGTLLFEWLRQGRIKPVDENLSVSMFEILIDKLSEAGFEQYEISNFAQSGYYSQHNSSYWNGAHYLGIGASAHSYNGISRRWNKKVHGAQYLDYGFEIEIIDRQTAYREFIITRLRTMKGIDLNELQELFGSEKQTYCLKRSQKYIDSHLLEISDNHLKLNKKGIFISDGIMSDLI
Sample Types
Isolate
5.2%
Metagenome
94.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
25.5%
Unclassified
15.7%
Rhinotermitidae
7.8%
Termopsidae
7.8%
Blattidae
3.9%
Passalidae
3.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 2 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 3 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 6 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 13 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 19 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 20 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 21 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 22 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 37 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_024287 | 3300042636 | Bacteria | 29560 |
| 2 | Ga0466703_361729 | 3300042636 | Bacteria | 4460 |
| 3 | Ga0466727_315593 | 3300042655 | Bacteria | 3286 |
| 4 | Ga0123357_10131326 | 3300009784 | Bacteria | 3117 |
| 5 | Ga0123357_10146536 | 3300009784 | Bacteria | 2881 |
| 6 | Ga0466705_450330 | 3300042612 | Bacteria | 2013 |
| 7 | Ga0466715_482629 | 3300042616 | Bacteria | 44538 |
| 8 | Ga0466723_093143 | 3300042618 | Bacteria | 13056 |
| 9 | Ga0466728_212504 | 3300042620 | Bacteria | 6823 |
| 10 | Ga0466692_038856 | 3300042591 | Bacteria | 66664 |
| 11 | Ga0123357_10000752 | 3300009784 | Bacteria | 32677 |
| 12 | Ga0466706_116089 | 3300042599 | Bacteria | 1520 |
| 13 | Ga0466706_149858 | 3300042599 | Bacteria | 2501 |
| 14 | Ga0466707_285694 | 3300042601 | Bacteria | 2122 |
| 15 | Ga0466713_065086 | 3300042602 | Bacteria | 42766 |
| 16 | Ga0466714_093285 | 3300042603 | Bacteria | 105352 |
| 17 | Ga0466703_220791 | 3300042636 | Bacteria | 10418 |
| 18 | Ga0466705_513213 | 3300042612 | Bacteria | 14206 |
| 19 | Ga0466711_181345 | 3300042615 | Unclassified | 1939 |
| 20 | Ga0466715_209082 | 3300042616 | Bacteria | 53914 |
| 21 | Ga0466723_318872 | 3300042618 | Bacteria | 11222 |
| 22 | Ga0466726_048500 | 3300042619 | Bacteria | 17749 |
| 23 | Ga0466693_006246 | 3300042592 | Bacteria | 1586 |
| 24 | IMNBL1DRAFT_c0001646 | 3300000062 | Unclassified | 16546 |
| 25 | JGI24699J35502_11133518 | 3300002509 | Bacteria | 11390 |
| 26 | Ga0068305_10110809 | 3300005083 | Bacteria | 18257 |
| 27 | Ga0466707_136298 | 3300042601 | Bacteria | 30628 |
| 28 | Ga0466719_162869 | 3300042606 | Bacteria | 4498 |
| 29 | Ga0466722_089301 | 3300042609 | Bacteria | 1273 |
| 30 | Ga0466704_257069 | 3300042643 | Bacteria | 13775 |
| 31 | Ga0123354_10164354 | 3300010882 | Unclassified | 2617 |
| 32 | Ga0466711_192068 | 3300042615 | Bacteria | 3932 |
| 33 | Ga0466726_280634 | 3300042619 | Bacteria | 10688 |
| 34 | Ga0466729_123714 | 3300042621 | Bacteria | 3518 |
| 35 | Ga0466692_156027 | 3300042591 | Bacteria | 99798 |
| 36 | Ga0466694_061060 | 3300042594 | Bacteria | 1643 |
| 37 | IMNBL1DRAFT_c0002749 | 3300000062 | Bacteria | 11956 |
| 38 | Ga0123357_10000643 | 3300009784 | Bacteria | 34739 |
| 39 | Ga0466707_105179 | 3300042601 | Bacteria | 2191 |
| 40 | Ga0466707_212815 | 3300042601 | Bacteria | 9655 |
| 41 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 42 | Ga0466722_121538 | 3300042609 | Bacteria | 4070 |
| 43 | Ga0466722_214681 | 3300042609 | Bacteria | 2584 |
| 44 | Ga0466697_279795 | 3300042611 | Bacteria | 1330 |
| 45 | Ga0466734_016857 | 3300042623 | Bacteria | 1820 |
| 46 | Ga0466727_170349 | 3300042655 | Bacteria | 8509 |
| 47 | Ga0466727_201287 | 3300042655 | Bacteria | 2351 |
| 48 | Ga0466727_280822 | 3300042655 | Bacteria | 1706 |
| 49 | Ga0123357_10117194 | 3300009784 | Bacteria | 3370 |
| 50 | Ga0123354_10002461 | 3300010882 | Bacteria | 24494 |
| 51 | Ga0123354_10009475 | 3300010882 | Bacteria | 14914 |
| 52 | Ga0466711_030070 | 3300042615 | Bacteria | 20514 |
| 53 | Ga0466715_413985 | 3300042616 | Bacteria | 7978 |
| 54 | Ga0456237_0000034 | 3300041968 | Unclassified | 20816 |
| 55 | Ga0466691_042754 | 3300042593 | Bacteria | 3673 |
| 56 | 2227530197 | 2225789004 | Bacteria | 3166 |
| 57 | JGI24702J35022_10022424 | 3300002462 | Bacteria | 3416 |
| 58 | JGI24705J35276_12173696 | 3300002504 | Bacteria | 1312 |
| 59 | JGI24699J35502_11134227 | 3300002509 | Bacteria | 76542 |
| 60 | JGI24696J40584_12959801 | 3300002834 | Bacteria | 5682 |
| 61 | Ga0466719_279935 | 3300042606 | Bacteria | 4960 |
| 62 | Ga0466729_230312 | 3300042621 | Bacteria | 17056 |
| 63 | Ga0466734_035501 | 3300042623 | Bacteria | 1267 |
| 64 | Ga0466735_000726 | 3300042624 | Bacteria | 3476 |
| 65 | Ga0466735_020374 | 3300042624 | Bacteria | 7254 |
| 66 | Ga0466703_304038 | 3300042636 | Bacteria | 3143 |
| 67 | Ga0466704_477462 | 3300042643 | Bacteria | 10469 |
| 68 | Ga0466727_037894 | 3300042655 | Bacteria | 109077 |
| 69 | Ga0466711_220516 | 3300042615 | Bacteria | 9688 |
| 70 | Ga0466723_199680 | 3300042618 | Bacteria | 21029 |
| 71 | Ga0466729_020019 | 3300042621 | Bacteria | 5257 |
| 72 | Ga0466656_210222 | 3300042550 | Bacteria | 2960 |
| 73 | Ga0466692_012061 | 3300042591 | Bacteria | 54313 |
| 74 | 2227472436 | 2225789004 | Bacteria | 4804 |
| 75 | Ga0466700_368773 | 3300042600 | Bacteria | 9286 |
| 76 | Ga0466707_068713 | 3300042601 | Bacteria | 9927 |
| 77 | Ga0466707_401729 | 3300042601 | Bacteria | 1974 |
| 78 | Ga0466713_134636 | 3300042602 | Bacteria | 5357 |
| 79 | Ga0466716_038510 | 3300042605 | Bacteria | 24976 |
| 80 | Ga0466735_140409 | 3300042624 | Bacteria | 3986 |
| 81 | Ga0466704_088792 | 3300042643 | Bacteria | 4794 |
| 82 | Ga0466704_492877 | 3300042643 | Bacteria | 18854 |
| 83 | Ga0466709_015483 | 3300042648 | Bacteria | 50381 |
| 84 | Ga0466727_011077 | 3300042655 | Bacteria | 9809 |
| 85 | Ga0123354_10193016 | 3300010882 | Bacteria | 2272 |
| 86 | Ga0466712_264540 | 3300042614 | Unclassified | 1602 |
| 87 | Ga0466711_114753 | 3300042615 | Bacteria | 4174 |
| 88 | Ga0466715_304574 | 3300042616 | Bacteria | 12623 |
| 89 | Ga0466723_262126 | 3300042618 | Bacteria | 3230 |
| 90 | Ga0466690_384914 | 3300042590 | Bacteria | 39355 |
| 91 | Ga0466692_103723 | 3300042591 | Bacteria | 34838 |
| 92 | Ga0466691_103843 | 3300042593 | Bacteria | 29120 |
| 93 | Ga0466691_165720 | 3300042593 | Bacteria | 3799 |
| 94 | Ga0466696_001820 | 3300042596 | Bacteria | 2803 |
| 95 | Ga0466696_159165 | 3300042596 | Bacteria | 5912 |
| 96 | JGI24702J35022_10004478 | 3300002462 | Bacteria | 8292 |
| 97 | JGI24699J35502_11134152 | 3300002509 | Bacteria | 38064 |
| 98 | Ga0466700_304692 | 3300042600 | Bacteria | 3349 |
| 99 | Ga0466707_147233 | 3300042601 | Bacteria | 6063 |
| 100 | Ga0466707_165483 | 3300042601 | Bacteria | 32826 |
| 101 | Ga0466722_140391 | 3300042609 | Bacteria | 11877 |
| 102 | Ga0466729_252130 | 3300042621 | Bacteria | 2286 |
| 103 | Ga0466703_382780 | 3300042636 | Bacteria | 2798 |
| 104 | Ga0466704_367215 | 3300042643 | Bacteria | 17146 |
| 105 | Ga0123357_10217344 | 3300009784 | Bacteria | 2130 |
| 106 | Ga0123353_10025466 | 3300010167 | Bacteria | 9016 |
| 107 | Ga0466715_466866 | 3300042616 | Bacteria | 12145 |
| 108 | Ga0466723_230466 | 3300042618 | Unclassified | 5505 |
| 109 | Ga0466726_313457 | 3300042619 | Bacteria | 11242 |
| 110 | JGI24702J35022_10118557 | 3300002462 | Bacteria | 1460 |
| 111 | Ga0466719_186264 | 3300042606 | Bacteria | 1465 |
| 112 | Ga0466735_090277 | 3300042624 | Bacteria | 12019 |
| 113 | Ga0466703_203134 | 3300042636 | Unclassified | 4206 |
| 114 | Ga0123354_10000498 | 3300010882 | Bacteria | 39457 |
| 115 | Ga0466711_091297 | 3300042615 | Bacteria | 6954 |
| 116 | Ga0466711_227446 | 3300042615 | Bacteria | 9593 |
| 117 | Ga0466715_340278 | 3300042616 | Bacteria | 1468 |
| 118 | Ga0466715_359091 | 3300042616 | Bacteria | 16012 |
| 119 | Ga0466690_118535 | 3300042590 | Bacteria | 11335 |
| 120 | Ga0466690_323305 | 3300042590 | Bacteria | 15425 |
| 121 | Ga0466692_046526 | 3300042591 | Bacteria | 3994 |
| 122 | Ga0466692_090996 | 3300042591 | Bacteria | 32249 |
| 123 | Ga0466692_161444 | 3300042591 | Bacteria | 3842 |
| 124 | 2227573800 | 2225789004 | Bacteria | 2586 |
| 125 | Ga0068302_10066918 | 3300005071 | Bacteria | 9116 |
| 126 | Ga0466701_034412 | 3300042598 | Bacteria | 13981 |
| 127 | Ga0466707_185685 | 3300042601 | Bacteria | 20469 |
| 128 | Ga0466698_024595 | 3300042610 | Bacteria | 3399 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042611 | Ga0466697_279795 | Ga0466697_279795_350_1315 | 321 |
| 2 | 3300042620 | Ga0466728_212504 | Ga0466728_212504_5838_6803 | 321 |
| 3 | 3300042614 | Ga0466712_264540 | Ga0466712_264540_171_1160 | 329 |
| 4 | 3300002509 | JGI24699J35502_11134152 | JGI24699J35502_1113415239 | 342 |
| 5 | 3300042592 | Ga0466693_006246 | Ga0466693_006246_522_1553 | 343 |
| 6 | 3300042615 | Ga0466711_220516 | Ga0466711_220516_4418_5449 | 343 |
| 7 | 3300042618 | Ga0466723_318872 | Ga0466723_318872_7725_8759 | 344 |
| 8 | iso_pr_bacteria | 2820751898 | 2820752646 | 344 |
| 9 | 3300042606 | Ga0466719_186264 | Ga0466719_186264_371_1411 | 346 |
| 10 | 3300042591 | Ga0466692_090996 | Ga0466692_090996_30524_31639 | 347 |
| 11 | 3300041968 | Ga0456237_0000034 | Ga0456237_0000034_552_1667 | 348 |
| 12 | 3300009784 | Ga0123357_10000643 | Ga0123357_1000064316 | 355 |
| 13 | 3300042602 | Ga0466713_065086 | Ga0466713_065086_13423_14493 | 356 |
| 14 | 3300042621 | Ga0466729_230312 | Ga0466729_230312_15579_16658 | 359 |
| 15 | 3300042591 | Ga0466692_046526 | Ga0466692_046526_1484_2572 | 362 |
| 16 | 3300042624 | Ga0466735_000726 | Ga0466735_000726_173_1270 | 365 |
| 17 | 3300042624 | Ga0466735_020374 | Ga0466735_020374_4592_5689 | 365 |
| 18 | 3300042636 | Ga0466703_203134 | Ga0466703_203134_2915_4012 | 365 |
| 19 | iso_pr_bacteria | 2967483437 | 2967485886 | 365 |
| 20 | 2225789004 | 2227472436 | 2227920288 | 366 |
| 21 | 2225789004 | 2227530197 | 2228041768 | 366 |
| 22 | 2225789004 | 2227573800 | 2228120713 | 366 |
| 23 | 3300042600 | Ga0466700_304692 | Ga0466700_304692_931_2031 | 366 |
| 24 | 3300000062 | IMNBL1DRAFT_c0001646 | IMNBL1DRAFT_000164614 | 367 |
| 25 | 3300000062 | IMNBL1DRAFT_c0002749 | IMNBL1DRAFT_00027498 | 367 |
| 26 | 3300002504 | JGI24705J35276_12173696 | JGI24705J35276_121736961 | 367 |
| 27 | iso_pr_bacteria | 2940216256 | 2940216820 | 367 |
| 28 | 3300042550 | Ga0466656_210222 | Ga0466656_210222_81_1187 | 368 |
| 29 | 3300042593 | Ga0466691_103843 | Ga0466691_103843_4363_5502 | 368 |
| 30 | 3300042594 | Ga0466694_061060 | Ga0466694_061060_258_1364 | 368 |
| 31 | 3300042596 | Ga0466696_001820 | Ga0466696_001820_669_1775 | 368 |
| 32 | 3300042600 | Ga0466700_368773 | Ga0466700_368773_3529_4635 | 368 |
| 33 | 3300042601 | Ga0466707_185685 | Ga0466707_185685_4861_5967 | 368 |
| 34 | 3300042610 | Ga0466698_024595 | Ga0466698_024595_2165_3271 | 368 |
| 35 | 3300042615 | Ga0466711_114753 | Ga0466711_114753_581_1687 | 368 |
| 36 | 3300042655 | Ga0466727_011077 | Ga0466727_011077_7518_8624 | 368 |
| 37 | 3300002462 | JGI24702J35022_10022424 | JGI24702J35022_100224242 | 369 |
| 38 | 3300002509 | JGI24699J35502_11133518 | JGI24699J35502_111335184 | 369 |
| 39 | 3300009784 | Ga0123357_10217344 | Ga0123357_102173442 | 369 |
| 40 | 3300010882 | Ga0123354_10000498 | Ga0123354_1000049838 | 369 |
| 41 | 3300042590 | Ga0466690_118535 | Ga0466690_118535_8299_9408 | 369 |
| 42 | 3300042609 | Ga0466722_121538 | Ga0466722_121538_697_1806 | 369 |
| 43 | 3300042609 | Ga0466722_140391 | Ga0466722_140391_6265_7374 | 369 |
| 44 | 3300042616 | Ga0466715_340278 | Ga0466715_340278_273_1382 | 369 |
| 45 | 3300042616 | Ga0466715_359091 | Ga0466715_359091_5553_6662 | 369 |
| 46 | 3300042618 | Ga0466723_093143 | Ga0466723_093143_4768_5877 | 369 |
| 47 | 3300042621 | Ga0466729_123714 | Ga0466729_123714_2006_3133 | 369 |
| 48 | 3300042623 | Ga0466734_035501 | Ga0466734_035501_46_1155 | 369 |
| 49 | 3300009784 | Ga0123357_10000752 | Ga0123357_1000075222 | 370 |
| 50 | 3300009784 | Ga0123357_10117194 | Ga0123357_101171944 | 370 |
| 51 | 3300009784 | Ga0123357_10131326 | Ga0123357_101313262 | 370 |
| 52 | 3300009784 | Ga0123357_10146536 | Ga0123357_101465362 | 370 |
| 53 | 3300010882 | Ga0123354_10009475 | Ga0123354_1000947511 | 370 |
| 54 | 3300010882 | Ga0123354_10164354 | Ga0123354_101643541 | 370 |
| 55 | 3300010882 | Ga0123354_10193016 | Ga0123354_101930163 | 370 |
| 56 | 3300042590 | Ga0466690_323305 | Ga0466690_323305_7175_8287 | 370 |
| 57 | 3300042619 | Ga0466726_313457 | Ga0466726_313457_9167_10279 | 370 |
| 58 | 3300042624 | Ga0466735_090277 | Ga0466735_090277_209_1321 | 370 |
| 59 | 3300042655 | Ga0466727_037894 | Ga0466727_037894_83318_84430 | 370 |
| 60 | 3300010167 | Ga0123353_10025466 | Ga0123353_100254665 | 371 |
| 61 | 3300042590 | Ga0466690_384914 | Ga0466690_384914_14178_15293 | 371 |
| 62 | 3300042591 | Ga0466692_012061 | Ga0466692_012061_32074_33189 | 371 |
| 63 | 3300042596 | Ga0466696_159165 | Ga0466696_159165_3527_4642 | 371 |
| 64 | 3300042609 | Ga0466722_214681 | Ga0466722_214681_266_1381 | 371 |
| 65 | 3300042616 | Ga0466715_304574 | Ga0466715_304574_2958_4073 | 371 |
| 66 | 3300042618 | Ga0466723_230466 | Ga0466723_230466_1062_2177 | 371 |
| 67 | 3300042636 | Ga0466703_382780 | Ga0466703_382780_645_1760 | 371 |
| 68 | 3300042643 | Ga0466704_088792 | Ga0466704_088792_601_1716 | 371 |
| 69 | 3300042643 | Ga0466704_367215 | Ga0466704_367215_9539_10654 | 371 |
| 70 | 3300042648 | Ga0466709_015483 | Ga0466709_015483_14146_15261 | 371 |
| 71 | 3300042655 | Ga0466727_170349 | Ga0466727_170349_460_1575 | 371 |
| 72 | iso_pr_bacteria | 643348524 | 643423091 | 371 |
| 73 | 3300042591 | Ga0466692_103723 | Ga0466692_103723_9020_10138 | 372 |
| 74 | 3300042605 | Ga0466716_038510 | Ga0466716_038510_22591_23709 | 372 |
| 75 | 3300042618 | Ga0466723_262126 | Ga0466723_262126_1833_2951 | 372 |
| 76 | 3300002462 | JGI24702J35022_10118557 | JGI24702J35022_101185571 | 373 |
| 77 | 3300042593 | Ga0466691_165720 | Ga0466691_165720_1305_2426 | 373 |
| 78 | 3300042601 | Ga0466707_147233 | Ga0466707_147233_1229_2350 | 373 |
| 79 | 3300042616 | Ga0466715_413985 | Ga0466715_413985_1735_2856 | 373 |
| 80 | 3300042655 | Ga0466727_315593 | Ga0466727_315593_37_1158 | 373 |
| 81 | 3300042599 | Ga0466706_116089 | Ga0466706_116089_344_1468 | 374 |
| 82 | 3300042602 | Ga0466713_134636 | Ga0466713_134636_4087_5211 | 374 |
| 83 | 3300042624 | Ga0466735_140409 | Ga0466735_140409_2807_3931 | 374 |
| 84 | 3300042655 | Ga0466727_201287 | Ga0466727_201287_406_1530 | 374 |
| 85 | iso_pr_bacteria | 2940199050 | 2940202049 | 374 |
| 86 | 3300002462 | JGI24702J35022_10004478 | JGI24702J35022_100044782 | 375 |
| 87 | 3300042599 | Ga0466706_149858 | Ga0466706_149858_134_1261 | 375 |
| 88 | 3300042606 | Ga0466719_162869 | Ga0466719_162869_1461_2588 | 375 |
| 89 | 3300042615 | Ga0466711_030070 | Ga0466711_030070_14929_16056 | 375 |
| 90 | 3300042616 | Ga0466715_466866 | Ga0466715_466866_668_1795 | 375 |
| 91 | iso_pr_bacteria | 2820757377 | 2820759676 | 375 |
| 92 | 3300042601 | Ga0466707_212815 | Ga0466707_212815_8331_9461 | 376 |
| 93 | 3300042602 | Ga0466713_100528 | Ga0466713_100528_31576_32706 | 376 |
| 94 | 3300042636 | Ga0466703_304038 | Ga0466703_304038_1504_2634 | 376 |
| 95 | iso_pr_bacteria | 2820776227 | 2820776671 | 376 |
| 96 | 3300042609 | Ga0466722_089301 | Ga0466722_089301_50_1183 | 377 |
| 97 | 3300042612 | Ga0466705_450330 | Ga0466705_450330_832_1965 | 377 |
| 98 | 3300042636 | Ga0466703_220791 | Ga0466703_220791_7297_8430 | 377 |
| 99 | 3300042619 | Ga0466726_048500 | Ga0466726_048500_8570_9706 | 378 |
| 100 | 3300005071 | Ga0068302_10066918 | Ga0068302_100669187 | 379 |
| 101 | 3300042612 | Ga0466705_513213 | Ga0466705_513213_9951_11090 | 379 |
| 102 | 3300042623 | Ga0466734_016857 | Ga0466734_016857_575_1714 | 379 |
| 103 | 3300042591 | Ga0466692_038856 | Ga0466692_038856_54358_55500 | 380 |
| 104 | 3300042636 | Ga0466703_361729 | Ga0466703_361729_336_1478 | 380 |
| 105 | 3300042655 | Ga0466727_280822 | Ga0466727_280822_54_1196 | 380 |
| 106 | 3300042603 | Ga0466714_093285 | Ga0466714_093285_103832_104977 | 381 |
| 107 | 3300042606 | Ga0466719_279935 | Ga0466719_279935_1044_2189 | 381 |
| 108 | 3300042643 | Ga0466704_257069 | Ga0466704_257069_10158_11303 | 381 |
| 109 | 3300005083 | Ga0068305_10110809 | Ga0068305_1011080914 | 382 |
| 110 | 3300042618 | Ga0466723_199680 | Ga0466723_199680_11017_12165 | 382 |
| 111 | 3300042619 | Ga0466726_280634 | Ga0466726_280634_8443_9591 | 382 |
| 112 | 3300042621 | Ga0466729_252130 | Ga0466729_252130_982_2130 | 382 |
| 113 | 3300042636 | Ga0466703_024287 | Ga0466703_024287_4305_5453 | 382 |
| 114 | 3300042643 | Ga0466704_477462 | Ga0466704_477462_3483_4631 | 382 |
| 115 | 3300042591 | Ga0466692_161444 | Ga0466692_161444_517_1668 | 383 |
| 116 | 3300042601 | Ga0466707_401729 | Ga0466707_401729_527_1678 | 383 |
| 117 | 3300042615 | Ga0466711_181345 | Ga0466711_181345_96_1247 | 383 |
| 118 | 3300042615 | Ga0466711_192068 | Ga0466711_192068_96_1247 | 383 |
| 119 | 3300042616 | Ga0466715_209082 | Ga0466715_209082_45138_46289 | 383 |
| 120 | 3300042616 | Ga0466715_482629 | Ga0466715_482629_20206_21357 | 383 |
| 121 | 3300042601 | Ga0466707_136298 | Ga0466707_136298_8237_9394 | 385 |
| 122 | 3300042615 | Ga0466711_091297 | Ga0466711_091297_5162_6319 | 385 |
| 123 | 3300002834 | JGI24696J40584_12959801 | JGI24696J40584_129598012 | 386 |
| 124 | 3300042601 | Ga0466707_105179 | Ga0466707_105179_836_1996 | 386 |
| 125 | 3300042601 | Ga0466707_285694 | Ga0466707_285694_749_1912 | 387 |
| 126 | 3300002509 | JGI24699J35502_11134227 | JGI24699J35502_111342276 | 389 |
| 127 | 3300042621 | Ga0466729_020019 | Ga0466729_020019_1493_2665 | 390 |
| 128 | 3300042643 | Ga0466704_492877 | Ga0466704_492877_14670_15842 | 390 |
| 129 | 3300042601 | Ga0466707_068713 | Ga0466707_068713_8013_9197 | 394 |
| 130 | 3300010882 | Ga0123354_10002461 | Ga0123354_1000246114 | 396 |
| 131 | 3300042593 | Ga0466691_042754 | Ga0466691_042754_2366_3565 | 399 |
| 132 | 3300042601 | Ga0466707_165483 | Ga0466707_165483_6137_7417 | 401 |
| 133 | 3300042598 | Ga0466701_034412 | Ga0466701_034412_9959_11167 | 402 |
| 134 | 3300042615 | Ga0466711_227446 | Ga0466711_227446_4814_6046 | 410 |
| 135 | 3300042591 | Ga0466692_156027 | Ga0466692_156027_77926_79287 | 453 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.