Protein Family IF04702

Metagenome Isolate
175 Members
66 Samples
156 Scaffolds
419.37 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_153769|Ga0466692_153769_3907_5421
Length
504 aa
Sequence
MSPLSAKKQRPFNKLAPKPDRVLREPRDFSGESPGLYNSNITKKERNLNRAGRVELHDSCSSFTIRPNERHRPVMAQYSLIKTLVELRGNPRACVFTEPLWGLSMNLCIPYASVYMLALGLKDADVGFIATVYMLTQVVSGLLGGVITDKLGRRKTTAIFDFISWSIPCLIWMRAQGFWFFFVAALFNGVMKVTTNSWDCLLVEDAEKSQVTRIYSLIIVCGQLSALFAPISSILVSRLTLVPAIRILYVNAFIVMTIKLLLLYFFSRETRTGVTRIQQTKGVSFFRLLAGYGGIFRIIGKSKGTIFSLVIAALVGAVGMVNNTFWQIIASKKILVPDPLLPLFPMFRSLLAIAFLFLVTPRLLKVNLRSPLLYGFAACIIGQAVLVLTPAEGVTRYLILCVSLVFDGFGLGTLMMMAESLVALHVDRAERARVMAIQHMIIMFATTPFGWIGGILSGMNRGFPFVLNIVLLAAGLGVTLFYYHRNPGEAMAGHENESPVSEQT

📊 Sample Types

Isolate 10.9%
Metagenome 89.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 34.4%
Termitidae 32.8%
Kalotermitidae 21.9%
Rhinotermitidae 6.2%
Termopsidae 4.7%

🌳 Taxonomy

Archaea 0
Bacteria 162
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
2 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
3 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
6 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
7 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
11 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
12 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
29 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
30 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
34 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
37 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
38 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
41 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
42 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
48 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
49 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
50 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
51 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
55 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
56 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
57 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
58 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
59 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
60 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
61 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
62 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
63 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
64 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
65 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
66 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10000545 3300009826 Bacteria 50565
2 Ga0123356_10000361 3300010049 Bacteria 51710
3 AustNasuHG_c1002300 3300000089 Bacteria 6895
4 Ga0264413_110804 3300024493 Bacteria 2561
5 Ga0466690_306767 3300042590 Bacteria 6939
6 Ga0466691_000817 3300042593 Bacteria 11709
7 Ga0466691_076251 3300042593 Bacteria 5037
8 Ga0466691_104086 3300042593 Bacteria 10835
9 Ga0466696_348440 3300042596 Bacteria 5431
10 Ga0466713_056644 3300042602 Bacteria 143033
11 Ga0466716_085974 3300042605 Bacteria 7895
12 Ga0466722_054210 3300042609 Bacteria 4501
13 Ga0466729_205641 3300042621 Bacteria 1500
14 Ga0466708_159329 3300042652 Bacteria 2278
15 Ga0466712_109596 3300042614 Bacteria 15349
16 Ga0466711_435382 3300042615 Bacteria 2741
17 Ga0466715_289164 3300042616 Bacteria 65907
18 Ga0466723_080142 3300042618 Bacteria 6159
19 Ga0466723_093211 3300042618 Bacteria 3179
20 Ga0123355_10001120 3300009826 Bacteria 37070
21 Ga0123354_10093437 3300010882 Bacteria 4135
22 Ga0123354_10142911 3300010882 Unclassified 2948
23 JGI24695J34938_10007268 3300002450 Bacteria 6522
24 JGI24699J35502_11125420 3300002509 Bacteria 3797
25 Ga0123357_10000406 3300009784 Bacteria 40984
26 Ga0466692_074461 3300042591 Bacteria 7859
27 Ga0466691_036890 3300042593 Bacteria 8259
28 Ga0466696_058664 3300042596 Bacteria 3602
29 Ga0466716_222007 3300042605 Bacteria 3642
30 Ga0466719_180187 3300042606 Bacteria 25290
31 Ga0466719_225450 3300042606 Bacteria 68670
32 Ga0466720_110807 3300042607 Bacteria 1838
33 Ga0466703_199713 3300042636 Bacteria 1738
34 Ga0466705_530876 3300042612 Bacteria 3096
35 Ga0466712_043020 3300042614 Bacteria 10399
36 Ga0466712_058877 3300042614 Bacteria 25182
37 Ga0466712_129938 3300042614 Bacteria 14577
38 Ga0466711_243993 3300042615 Bacteria 10588
39 Ga0123357_10021504 3300009784 Unclassified 8639
40 JGI24699J35502_11093422 3300002509 Bacteria 2183
41 JGI24699J35502_11134221 3300002509 Bacteria 67001
42 Ga0123357_10000916 3300009784 Bacteria 29940
43 Ga0466690_045368 3300042590 Bacteria 6022
44 Ga0466690_339415 3300042590 Bacteria 9655
45 Ga0466692_088613 3300042591 Unclassified 1800
46 Ga0466692_097328 3300042591 Bacteria 28105
47 Ga0466716_072807 3300042605 Bacteria 11205
48 Ga0466719_055835 3300042606 Unclassified 4764
49 Ga0466722_078774 3300042609 Bacteria 13469
50 Ga0466731_305804 3300042622 Bacteria 5372
51 Ga0466708_056844 3300042652 Bacteria 13240
52 Ga0466725_411436 3300042654 Bacteria 3582
53 Ga0466715_092636 3300042616 Bacteria 18886
54 Ga0466715_210163 3300042616 Bacteria 48320
55 Ga0466723_230343 3300042618 Bacteria 8895
56 Ga0466723_293452 3300042618 Bacteria 17268
57 Ga0123354_10023196 3300010882 Bacteria 9788
58 JGI24698J34947_10001002 3300002449 Bacteria 14498
59 JGI24698J34947_10006174 3300002449 Unclassified 6581
60 JGI24695J34938_10000172 3300002450 Bacteria 60289
61 JGI24695J34938_10005837 3300002450 Bacteria 7572
62 JGI24695J34938_10009573 3300002450 Bacteria 5378
63 JGI24695J34938_10027660 3300002450 Bacteria 2677
64 Ga0264413_101220 3300024493 Bacteria 47245
65 Ga0466692_153769 3300042591 Bacteria 29297
66 Ga0466694_379709 3300042594 Bacteria 72022
67 Ga0466707_008801 3300042601 Bacteria 4974
68 Ga0466719_036914 3300042606 Bacteria 9855
69 Ga0466720_009545 3300042607 Unclassified 2295
70 Ga0466720_098710 3300042607 Bacteria 26481
71 Ga0466731_112040 3300042622 Bacteria 4113
72 Ga0466731_337384 3300042622 Bacteria 6120
73 Ga0466708_330747 3300042652 Bacteria 6589
74 Ga0466727_011086 3300042655 Bacteria 4563
75 Ga0466705_168307 3300042612 Bacteria 17645
76 Ga0466711_048039 3300042615 Bacteria 4434
77 Ga0466715_136346 3300042616 Bacteria 9194
78 Ga0466723_182417 3300042618 Bacteria 25448
79 Ga0466726_057668 3300042619 Unclassified 1419
80 Ga0466728_100043 3300042620 Bacteria 11491
81 Ga0123353_10435414 3300010167 Bacteria 1937
82 Ga0123353_10496053 3300010167 Bacteria 1781
83 Ga0466733_196049 3300042659 Bacteria 14805
84 JGI24705J35276_12221912 3300002504 Bacteria 2378
85 Ga0123357_10002662 3300009784 Unclassified 20095
86 Ga0456237_0002256 3300041968 Unclassified 3120
87 Ga0466694_005840 3300042594 Bacteria 106514
88 Ga0466696_474966 3300042596 Bacteria 7751
89 Ga0466707_302191 3300042601 Bacteria 41985
90 Ga0466713_110759 3300042602 Bacteria 2660
91 Ga0466719_207422 3300042606 Bacteria 16146
92 Ga0466722_152482 3300042609 Bacteria 7586
93 Ga0466698_003252 3300042610 Bacteria 17096
94 Ga0466729_309375 3300042621 Bacteria 2689
95 Ga0466735_186691 3300042624 Bacteria 9243
96 Ga0466704_044581 3300042643 Bacteria 14955
97 Ga0466708_062527 3300042652 Bacteria 36730
98 Ga0466727_331114 3300042655 Bacteria 6501
99 Ga0466705_219458 3300042612 Bacteria 14353
100 Ga0466723_325977 3300042618 Bacteria 2746
101 Ga0466728_222275 3300042620 Bacteria 2803
102 Ga0123357_10156715 3300009784 Bacteria 2744
103 Ga0123355_10020532 3300009826 Bacteria 10553
104 Ga0123355_10114031 3300009826 Bacteria 4214
105 Ga0123355_10222549 3300009826 Bacteria 2711
106 Ga0123353_10086006 3300010167 Bacteria 5064
107 JGI24695J34938_10001213 3300002450 Bacteria 22849
108 JGI24695J34938_10025786 3300002450 Bacteria 2804
109 JGI24702J35022_10002110 3300002462 Bacteria 12275
110 Ga0068305_10916328 3300005083 Bacteria 3655
111 Ga0466691_108325 3300042593 Bacteria 6537
112 Ga0466696_034713 3300042596 Bacteria 5220
113 Ga0466707_064613 3300042601 Bacteria 2890
114 Ga0466707_287266 3300042601 Bacteria 2132
115 Ga0466707_389627 3300042601 Bacteria 1646
116 Ga0466719_113646 3300042606 Unclassified 2613
117 Ga0466735_167931 3300042624 Bacteria 1465
118 Ga0466703_013758 3300042636 Bacteria 5258
119 Ga0466704_094942 3300042643 Bacteria 57318
120 Ga0466704_343782 3300042643 Bacteria 17755
121 Ga0466708_220002 3300042652 Bacteria 3896
122 Ga0466705_120845 3300042612 Bacteria 5539
123 Ga0466712_047061 3300042614 Bacteria 14486
124 Ga0466726_390944 3300042619 Bacteria 1897
125 Ga0466728_223723 3300042620 Bacteria 3979
126 Ga0123353_10284283 3300010167 Bacteria 2538
127 Ga0466733_007397 3300042659 Bacteria 3434
128 JGI24703J35330_11741224 3300002501 Bacteria 3520
129 Ga0072940_1019611 3300005200 Bacteria 11713
130 Ga0264413_122738 3300024493 Bacteria 4590
131 Ga0466692_115606 3300042591 Bacteria 2199
132 Ga0466691_209139 3300042593 Bacteria 9020
133 Ga0466716_114793 3300042605 Bacteria 22083
134 Ga0466709_331234 3300042648 Bacteria 9370
135 Ga0466708_015554 3300042652 Bacteria 30533
136 Ga0466715_057623 3300042616 Bacteria 7552
137 Ga0466718_057343 3300042617 Bacteria 5522
138 Ga0466726_365482 3300042619 Bacteria 1839
139 Ga0123356_10000289 3300010049 Bacteria 57741
140 Ga0123356_10000624 3300010049 Bacteria 39100
141 Ga0123356_10005725 3300010049 Bacteria 12629
142 Ga0123353_10011967 3300010167 Bacteria 12278
143 Ga0072941_1005991 3300005201 Bacteria 8325
144 Ga0466694_139788 3300042594 Bacteria 2342
145 Ga0466716_501010 3300042605 Bacteria 3885
146 Ga0466722_133019 3300042609 Unclassified 2883
147 Ga0466703_048387 3300042636 Bacteria 27078
148 Ga0466703_232815 3300042636 Unclassified 4739
149 Ga0466704_053949 3300042643 Bacteria 11015
150 Ga0466704_334066 3300042643 Bacteria 5467
151 Ga0466704_414935 3300042643 Bacteria 5677
152 Ga0466709_144867 3300042648 Bacteria 8129
153 Ga0466712_072051 3300042614 Bacteria 23884
154 Ga0466723_211837 3300042618 Bacteria 8397
155 Ga0466723_364265 3300042618 Bacteria 16673
156 Ga0466729_143876 3300042621 Unclassified 2444

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10222549 Ga0123355_102225492 382
2 3300009784 Ga0123357_10021504 Ga0123357_100215047 385
3 3300009784 Ga0123357_10002662 Ga0123357_1000266218 389
4 3300002450 JGI24695J34938_10001213 JGI24695J34938_1000121315 395
5 3300002509 JGI24699J35502_11125420 JGI24699J35502_111254202 396
6 3300042624 Ga0466735_186691 Ga0466735_186691_2740_3939 399
7 3300009784 Ga0123357_10000916 Ga0123357_100009161 400
8 3300042609 Ga0466722_152482 Ga0466722_152482_841_2148 401
9 3300005083 Ga0068305_10916328 Ga0068305_109163282 405
10 3300042602 Ga0466713_110759 Ga0466713_110759_178_1449 405
11 3300042616 Ga0466715_210163 Ga0466715_210163_27989_29206 405
12 3300042618 Ga0466723_211837 Ga0466723_211837_2249_3466 405
13 3300042636 Ga0466703_199713 Ga0466703_199713_270_1487 405
14 3300042648 Ga0466709_331234 Ga0466709_331234_8085_9302 405
15 3300000089 AustNasuHG_c1002300 AustNasuHG_10023005 406
16 3300002462 JGI24702J35022_10002110 JGI24702J35022_100021107 406
17 3300002509 JGI24699J35502_11093422 JGI24699J35502_110934222 406
18 3300042596 Ga0466696_034713 Ga0466696_034713_1858_3078 406
19 3300002504 JGI24705J35276_12221912 JGI24705J35276_122219121 407
20 3300010049 Ga0123356_10000289 Ga0123356_1000028920 407
21 3300010882 Ga0123354_10142911 Ga0123354_101429112 408
22 3300042655 Ga0466727_331114 Ga0466727_331114_4363_5589 408
23 3300002450 JGI24695J34938_10005837 JGI24695J34938_100058375 409
24 3300009826 Ga0123355_10114031 Ga0123355_101140311 410
25 3300010049 Ga0123356_10000361 Ga0123356_1000036134 410
26 3300042609 Ga0466722_054210 Ga0466722_054210_420_1703 411
27 3300042612 Ga0466705_120845 Ga0466705_120845_1126_2361 411
28 iso_pr_bacteria 2781125690 2781427507 411
29 3300002450 JGI24695J34938_10000172 JGI24695J34938_1000017229 412
30 3300010167 Ga0123353_10496053 Ga0123353_104960531 412
31 3300042602 Ga0466713_056644 Ga0466713_056644_82675_83988 412
32 3300042607 Ga0466720_009545 Ga0466720_009545_982_2220 412
33 3300042601 Ga0466707_389627 Ga0466707_389627_115_1356 413
34 3300042605 Ga0466716_072807 Ga0466716_072807_716_1978 413
35 3300002450 JGI24695J34938_10007268 JGI24695J34938_100072682 414
36 3300010167 Ga0123353_10011967 Ga0123353_100119676 414
37 3300042594 Ga0466694_005840 Ga0466694_005840_59808_61073 414
38 3300042616 Ga0466715_092636 Ga0466715_092636_17135_18379 414
39 3300002501 JGI24703J35330_11741224 JGI24703J35330_117412242 415
40 3300024493 Ga0264413_122738 Ga0264413_1227381 415
41 3300042620 Ga0466728_100043 Ga0466728_100043_3002_4249 415
42 3300024493 Ga0264413_110804 Ga0264413_1108044 416
43 3300042590 Ga0466690_306767 Ga0466690_306767_1855_3162 416
44 3300042590 Ga0466690_339415 Ga0466690_339415_1192_2442 416
45 3300042591 Ga0466692_088613 Ga0466692_088613_365_1615 416
46 3300042593 Ga0466691_104086 Ga0466691_104086_468_1718 416
47 3300042610 Ga0466698_003252 Ga0466698_003252_12587_13837 416
48 3300042612 Ga0466705_219458 Ga0466705_219458_12643_13893 416
49 3300042614 Ga0466712_047061 Ga0466712_047061_3042_4292 416
50 3300042614 Ga0466712_072051 Ga0466712_072051_5342_6592 416
51 3300042618 Ga0466723_364265 Ga0466723_364265_1570_2820 416
52 3300042624 Ga0466735_167931 Ga0466735_167931_56_1306 416
53 3300042643 Ga0466704_094942 Ga0466704_094942_17690_18940 416
54 3300042648 Ga0466709_144867 Ga0466709_144867_239_1489 416
55 3300042652 Ga0466708_015554 Ga0466708_015554_18877_20127 416
56 3300042652 Ga0466708_220002 Ga0466708_220002_1340_2590 416
57 3300042590 Ga0466690_045368 Ga0466690_045368_4145_5398 417
58 3300042591 Ga0466692_074461 Ga0466692_074461_2976_4229 417
59 3300042606 Ga0466719_055835 Ga0466719_055835_934_2187 417
60 3300042606 Ga0466719_180187 Ga0466719_180187_7490_8743 417
61 3300042606 Ga0466719_207422 Ga0466719_207422_4583_5836 417
62 3300042616 Ga0466715_289164 Ga0466715_289164_35452_36705 417
63 3300042618 Ga0466723_293452 Ga0466723_293452_71_1324 417
64 3300042643 Ga0466704_334066 Ga0466704_334066_311_1564 417
65 3300042643 Ga0466704_414935 Ga0466704_414935_649_1902 417
66 3300042652 Ga0466708_159329 Ga0466708_159329_52_1305 417
67 3300042655 Ga0466727_011086 Ga0466727_011086_62_1315 417
68 iso_pr_bacteria 2781125686 2781419389 417
69 3300005200 Ga0072940_1019611 Ga0072940_101961110 418
70 3300010167 Ga0123353_10086006 Ga0123353_100860064 418
71 3300024493 Ga0264413_101220 Ga0264413_10122036 418
72 3300042593 Ga0466691_036890 Ga0466691_036890_148_1404 418
73 3300042594 Ga0466694_139788 Ga0466694_139788_1065_2321 418
74 3300042594 Ga0466694_379709 Ga0466694_379709_65107_66387 418
75 3300042601 Ga0466707_287266 Ga0466707_287266_490_1746 418
76 3300042605 Ga0466716_114793 Ga0466716_114793_19177_20466 418
77 3300042619 Ga0466726_057668 Ga0466726_057668_107_1363 418
78 3300042620 Ga0466728_223723 Ga0466728_223723_2587_3843 418
79 3300042652 Ga0466708_330747 Ga0466708_330747_3785_5041 418
80 iso_pr_bacteria 2781125664 2781339952 418
81 3300010049 Ga0123356_10005725 Ga0123356_100057252 419
82 3300042605 Ga0466716_085974 Ga0466716_085974_2543_3802 419
83 3300042606 Ga0466719_225450 Ga0466719_225450_64635_65894 419
84 3300042607 Ga0466720_098710 Ga0466720_098710_6246_7505 419
85 3300042615 Ga0466711_435382 Ga0466711_435382_960_2219 419
86 3300042617 Ga0466718_057343 Ga0466718_057343_187_1446 419
87 3300042618 Ga0466723_230343 Ga0466723_230343_2685_3944 419
88 3300042621 Ga0466729_205641 Ga0466729_205641_55_1314 419
89 3300042622 Ga0466731_337384 Ga0466731_337384_3425_4684 419
90 3300042636 Ga0466703_013758 Ga0466703_013758_944_2203 419
91 3300042643 Ga0466704_343782 Ga0466704_343782_445_1704 419
92 3300042659 Ga0466733_196049 Ga0466733_196049_161_1420 419
93 iso_pr_bacteria 2781125634 2781274542 419
94 iso_pr_bacteria 2781125646 2781302020 419
95 iso_pr_bacteria 2781125647 2781303567 419
96 iso_pr_bacteria 2781125648 2781304479 419
97 iso_pr_bacteria 2781125650 2781309298 419
98 iso_pr_bacteria 2781125657 2781323427 419
99 iso_pr_bacteria 2781125661 2781333003 419
100 iso_pr_bacteria 2781125665 2781341483 419
101 3300002450 JGI24695J34938_10009573 JGI24695J34938_100095732 420
102 3300002450 JGI24695J34938_10025786 JGI24695J34938_100257862 420
103 3300005201 Ga0072941_1005991 Ga0072941_10059913 420
104 3300010049 Ga0123356_10000624 Ga0123356_1000062432 420
105 3300042618 Ga0466723_080142 Ga0466723_080142_261_1562 420
106 3300010167 Ga0123353_10435414 Ga0123353_104354142 421
107 3300042591 Ga0466692_097328 Ga0466692_097328_18465_19730 421
108 3300042593 Ga0466691_000817 Ga0466691_000817_9670_10935 421
109 3300042606 Ga0466719_113646 Ga0466719_113646_385_1671 421
110 3300042607 Ga0466720_110807 Ga0466720_110807_191_1456 421
111 3300042615 Ga0466711_243993 Ga0466711_243993_2141_3406 421
112 3300042622 Ga0466731_112040 Ga0466731_112040_779_2113 421
113 3300042652 Ga0466708_062527 Ga0466708_062527_29057_30349 421
114 iso_pr_bacteria 2781125640 2781289181 421
115 3300002450 JGI24695J34938_10027660 JGI24695J34938_100276602 422
116 3300041968 Ga0456237_0002256 Ga0456237_0002256_1615_2883 422
117 3300042618 Ga0466723_325977 Ga0466723_325977_1188_2456 422
118 3300042619 Ga0466726_365482 Ga0466726_365482_339_1607 422
119 3300042622 Ga0466731_305804 Ga0466731_305804_1354_2622 422
120 3300042643 Ga0466704_044581 Ga0466704_044581_2590_3858 422
121 3300042643 Ga0466704_053949 Ga0466704_053949_9270_10538 422
122 3300042596 Ga0466696_348440 Ga0466696_348440_1918_3189 423
123 3300042614 Ga0466712_043020 Ga0466712_043020_2497_3768 423
124 3300042614 Ga0466712_058877 Ga0466712_058877_6083_7354 423
125 3300042614 Ga0466712_109596 Ga0466712_109596_2253_3524 423
126 3300042621 Ga0466729_309375 Ga0466729_309375_100_1371 423
127 3300042652 Ga0466708_056844 Ga0466708_056844_10248_11519 423
128 iso_pr_bacteria 2781125693 2781433162 423
129 3300002449 JGI24698J34947_10001002 JGI24698J34947_1000100215 424
130 3300002449 JGI24698J34947_10006174 JGI24698J34947_100061744 424
131 3300042596 Ga0466696_058664 Ga0466696_058664_2207_3481 424
132 3300042601 Ga0466707_008801 Ga0466707_008801_1959_3233 424
133 3300042618 Ga0466723_093211 Ga0466723_093211_1755_3029 424
134 iso_pr_bacteria 2781125662 2781335772 424
135 iso_pr_bacteria 2820488713 2820489508 424
136 iso_pr_bacteria 2820899690 2820899952 424
137 3300002509 JGI24699J35502_11134221 JGI24699J35502_1113422118 425
138 iso_pr_bacteria 2820533259 2820534654 425
139 iso_pr_bacteria 2820829137 2820830072 425
140 3300009826 Ga0123355_10000545 Ga0123355_1000054531 426
141 3300009826 Ga0123355_10020532 Ga0123355_1002053214 426
142 3300042609 Ga0466722_078774 Ga0466722_078774_10080_11360 426
143 3300042591 Ga0466692_115606 Ga0466692_115606_358_1641 427
144 3300042609 Ga0466722_133019 Ga0466722_133019_224_1507 427
145 3300042615 Ga0466711_048039 Ga0466711_048039_640_1938 427
146 3300042636 Ga0466703_048387 Ga0466703_048387_17390_18676 428
147 iso_pr_bacteria 2820909719 2820910303 428
148 3300009784 Ga0123357_10000406 Ga0123357_1000040628 429
149 3300010167 Ga0123353_10284283 Ga0123353_102842831 429
150 3300042593 Ga0466691_108325 Ga0466691_108325_4095_5384 429
151 3300042601 Ga0466707_064613 Ga0466707_064613_1122_2411 429
152 3300042605 Ga0466716_222007 Ga0466716_222007_1085_2374 429
153 3300042605 Ga0466716_501010 Ga0466716_501010_1559_2848 429
154 3300042612 Ga0466705_168307 Ga0466705_168307_4337_5626 429
155 3300042614 Ga0466712_129938 Ga0466712_129938_411_1700 429
156 3300042654 Ga0466725_411436 Ga0466725_411436_192_1484 430
157 3300010882 Ga0123354_10023196 Ga0123354_100231962 431
158 3300042593 Ga0466691_209139 Ga0466691_209139_4793_6106 431
159 3300042596 Ga0466696_474966 Ga0466696_474966_6379_7692 431
160 3300042616 Ga0466715_057623 Ga0466715_057623_5709_7004 431
161 3300042616 Ga0466715_136346 Ga0466715_136346_6629_7942 431
162 3300042636 Ga0466703_232815 Ga0466703_232815_723_2036 431
163 3300009826 Ga0123355_10001120 Ga0123355_1000112011 433
164 3300042659 Ga0466733_007397 Ga0466733_007397_1973_3274 433
165 3300009784 Ga0123357_10156715 Ga0123357_101567152 434
166 3300042601 Ga0466707_302191 Ga0466707_302191_12982_14295 437
167 3300042606 Ga0466719_036914 Ga0466719_036914_2402_3715 437
168 3300042612 Ga0466705_530876 Ga0466705_530876_1147_2460 437
169 3300042618 Ga0466723_182417 Ga0466723_182417_3423_4736 437
170 3300042619 Ga0466726_390944 Ga0466726_390944_508_1821 437
171 3300042620 Ga0466728_222275 Ga0466728_222275_1114_2427 437
172 3300042621 Ga0466729_143876 Ga0466729_143876_983_2386 437
173 3300042593 Ga0466691_076251 Ga0466691_076251_3026_4348 440
174 3300010882 Ga0123354_10093437 Ga0123354_100934373 445
175 3300042591 Ga0466692_153769 Ga0466692_153769_3907_5421 504

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07690 MFS_1 Major Facilitator Superfamily 350 492 0.82
PF12832 MFS_1_like MFS_1 like family 108 459 0.75

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.