Protein Family IF04678

Metagenome Isolate
171 Members
60 Samples
151 Scaffolds
717.72 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_118411|Ga0466692_118411_24047_26656
Length
856 aa
Sequence
VLLSGENAQKATCFVDGFPFCVRERLVAEIGIHPDFGRSYSPHSHSFMVQHHLLQLFASCPLFADATAGATAQAAGLDPKVLFWGVPGASFLALLFAFLFYKGMKNADPGTALMQKIAQHVREGAMAYLTQQYKVVGLFFIVLTGVFAWLAYGMGIQNKWVPFAFITGGFFSGLAGFFGMKTATYASSRVAAAAQKSLNSGLQVAFRSGAVMGLVVVGLALLDISIWFLVLNHFIEDSPQKLTVITTTMLTFGMGASLQALFARVGGGIYTKAADVGADLAGKVVAGLNEDDPNNPATIADADLYESYAGSILATAALGAAGVTAFGXIGAKAGLAADPNLGYKLVMAPMLIAAVGTVLSILGIYVVRTKEGATQRNLLAALAKGVNFSSILITALSFGVLYLLNVPNYLGIWGAIVTGLVAGIIIGKSTEYYTSQEYGPTKHIAANGETGPATVIISGIGVGMLSTAIPVVVISIGTALAYCFASGDWHFAPESMAAGLYGIGIAAVGMLSTLGITLATDAYGPIADNAGGNAEMGRLPAEVRKRTDALDALGNTTAATGKGFAIGSAALTALALLASYVEELKIAMHHVLEPVFGKDGVAAATFGQFLVWDKDHAATAEAIKTGTSGHATDGVAIASANLTQFMDFFQVNLMNPKVIIGLFIGAMMSFLFCGLTMNAVGRAAKSMVQEICRQFRNAGILDAGNKVVEKFRNKEGTIDFPEGFTPDYATCVGISTRGAQREMVVPSLIAVVVPILTGVVFGVPGVFGLLGGGLSAGFVLAVFMANAGGAWDNAKKYIEEGHHGGKRSEAHKATVIGDTVGDPFKDTSGPSLNILIKLMSMVSIVTAGVNIYITLL

📊 Sample Types

Isolate 11.7%
Metagenome 88.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 28.3%
Termitidae 25.0%
Kalotermitidae 23.3%
Blattidae 10.0%
Rhinotermitidae 5.0%
Termopsidae 3.3%
Passalidae 3.3%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 166
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
5 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
6 3004667792 Bacteroides sp. 519 Isolate Blattidae
7 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
8 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
9 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
10 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
11 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
12 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
13 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
14 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
25 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
26 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
27 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
33 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
34 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
35 650716102 Treponema primitia ZAS-2 Isolate Unclassified
36 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
37 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
41 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
42 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
47 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
48 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
49 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
50 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
51 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
52 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
53 3004677695 Bacteroides sp. 214 Isolate Blattidae
54 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
55 3004672520 Bacteroides sp. 51 Isolate Blattidae
56 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
57 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
58 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
59 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
60 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_463590 3300042615 Bacteria 5622
2 Ga0466715_039960 3300042616 Bacteria 44642
3 Ga0466723_103492 3300042618 Bacteria 14835
4 Ga0466723_169212 3300042618 Bacteria 16692
5 Ga0466723_279912 3300042618 Bacteria 33283
6 Ga0466726_010571 3300042619 Bacteria 5248
7 Ga0466690_147872 3300042590 Bacteria 9153
8 Ga0466692_118411 3300042591 Bacteria 69710
9 Ga0466696_371836 3300042596 Bacteria 9410
10 Ga0466706_086537 3300042599 Bacteria 12006
11 Ga0466720_124322 3300042607 Bacteria 18270
12 Ga0466703_019944 3300042636 Bacteria 10718
13 Ga0466703_207338 3300042636 Bacteria 2387
14 Ga0466709_108250 3300042648 Bacteria 14580
15 Ga0466709_182034 3300042648 Bacteria 4057
16 Ga0466708_026866 3300042652 Bacteria 20807
17 Ga0466708_241112 3300042652 Unclassified 3571
18 Ga0466727_000346 3300042655 Bacteria 2649
19 Ga0466727_052226 3300042655 Bacteria 15747
20 Ga0466733_190994 3300042659 Bacteria 3648
21 Ga0123356_10072728 3300010049 Bacteria 3231
22 Ga0123353_10165977 3300010167 Bacteria 3509
23 Ga0466715_297858 3300042616 Bacteria 6146
24 Ga0466690_043882 3300042590 Unclassified 21867
25 Ga0466690_340070 3300042590 Bacteria 7261
26 Ga0466696_266425 3300042596 Bacteria 54685
27 Ga0466713_009751 3300042602 Bacteria 10633
28 Ga0466713_090562 3300042602 Bacteria 7684
29 Ga0466714_058710 3300042603 Bacteria 109931
30 Ga0466717_022094 3300042604 Bacteria 2845
31 Ga0466716_428069 3300042605 Bacteria 6481
32 JGI24695J34938_10011242 3300002450 Bacteria 4834
33 Ga0466703_117837 3300042636 Bacteria 9601
34 Ga0466704_148253 3300042643 Bacteria 20299
35 Ga0466709_039622 3300042648 Bacteria 20117
36 Ga0466708_204370 3300042652 Bacteria 37607
37 Ga0466733_086329 3300042659 Bacteria 16311
38 Ga0123356_10097971 3300010049 Bacteria 2806
39 Ga0123353_10086595 3300010167 Bacteria 5045
40 Ga0466711_388295 3300042615 Bacteria 24101
41 Ga0466715_521599 3300042616 Bacteria 20532
42 Ga0466723_042477 3300042618 Bacteria 16339
43 Ga0466690_139114 3300042590 Bacteria 89408
44 Ga0466690_345987 3300042590 Bacteria 4925
45 Ga0466699_225475 3300042597 Bacteria 5049
46 Ga0466706_058713 3300042599 Bacteria 36381
47 Ga0466706_068107 3300042599 Bacteria 19027
48 Ga0466722_261554 3300042609 Bacteria 74167
49 JGI24702J35022_10000346 3300002462 Bacteria 27413
50 JGI24699J35502_11134203 3300002509 Bacteria 55646
51 Ga0466703_045500 3300042636 Bacteria 15417
52 Ga0466732_324983 3300042656 Bacteria 2341
53 Ga0466715_180294 3300042616 Bacteria 21237
54 Ga0466718_113134 3300042617 Bacteria 21690
55 Ga0466728_128920 3300042620 Bacteria 22012
56 Ga0466729_118941 3300042621 Bacteria 18876
57 Ga0466696_115730 3300042596 Bacteria 9668
58 Ga0466696_339196 3300042596 Bacteria 71315
59 Ga0466696_426272 3300042596 Bacteria 2930
60 Ga0466696_457291 3300042596 Bacteria 48176
61 Ga0466707_038954 3300042601 Bacteria 5787
62 Ga0466707_246922 3300042601 Bacteria 20410
63 Ga0466714_168924 3300042603 Bacteria 42928
64 Ga0466717_098479 3300042604 Bacteria 3647
65 Ga0466722_029980 3300042609 Bacteria 9584
66 Ga0466703_064776 3300042636 Bacteria 55980
67 Ga0466703_233191 3300042636 Bacteria 10477
68 Ga0466703_424561 3300042636 Bacteria 85024
69 Ga0466704_035412 3300042643 Bacteria 12793
70 Ga0466704_196131 3300042643 Bacteria 3359
71 Ga0466704_418656 3300042643 Bacteria 5018
72 Ga0466709_216689 3300042648 Bacteria 32337
73 Ga0466725_048677 3300042654 Bacteria 5280
74 Ga0466727_287908 3300042655 Bacteria 2900
75 Ga0466733_004006 3300042659 Bacteria 20198
76 Ga0123356_10012204 3300010049 Bacteria 8351
77 Ga0123353_10000014 3300010167 Bacteria 204767
78 Ga0466711_449989 3300042615 Bacteria 9021
79 Ga0466728_261923 3300042620 Bacteria 5861
80 Ga0466690_207162 3300042590 Bacteria 17260
81 Ga0466690_292648 3300042590 Bacteria 7083
82 Ga0466691_146428 3300042593 Unclassified 4732
83 Ga0466696_231994 3300042596 Bacteria 8749
84 Ga0466696_238108 3300042596 Bacteria 5416
85 Ga0466707_152657 3300042601 Bacteria 24182
86 Ga0466714_169924 3300042603 Bacteria 44877
87 Ga0466716_086220 3300042605 Bacteria 79709
88 Ga0466716_154143 3300042605 Bacteria 20045
89 Ga0466720_190193 3300042607 Bacteria 11124
90 Ga0466722_185267 3300042609 Bacteria 2636
91 2227535714 2225789004 Bacteria 63282
92 Ga0466731_266551 3300042622 Bacteria 3470
93 Ga0466703_408191 3300042636 Bacteria 15894
94 Ga0466703_424595 3300042636 Bacteria 3969
95 Ga0466727_292959 3300042655 Bacteria 2528
96 Ga0466705_054211 3300042612 Bacteria 8753
97 Ga0466711_509301 3300042615 Bacteria 1915
98 Ga0466715_072088 3300042616 Bacteria 72248
99 Ga0466718_151327 3300042617 Bacteria 49244
100 Ga0466723_096641 3300042618 Bacteria 6511
101 Ga0466723_203179 3300042618 Bacteria 10673
102 Ga0466728_295496 3300042620 Bacteria 96280
103 Ga0466690_417680 3300042590 Bacteria 7746
104 Ga0466692_051289 3300042591 Bacteria 30117
105 Ga0466691_014326 3300042593 Bacteria 7362
106 Ga0466713_020992 3300042602 Bacteria 62959
107 Ga0466713_100430 3300042602 Bacteria 8063
108 Ga0466714_125685 3300042603 Bacteria 11617
109 Ga0466719_354122 3300042606 Bacteria 56234
110 Ga0466720_019857 3300042607 Bacteria 6249
111 IMNBL1DRAFT_c0000475 3300000062 Bacteria 33592
112 JGI24702J35022_10000563 3300002462 Bacteria 22435
113 JGI24702J35022_10003605 3300002462 Bacteria 9320
114 Ga0466731_382687 3300042622 Bacteria 13236
115 Ga0466705_019972 3300042612 Bacteria 2736
116 Ga0466733_092754 3300042659 Bacteria 31498
117 Ga0466733_122810 3300042659 Bacteria 13318
118 Ga0466715_135731 3300042616 Bacteria 13080
119 Ga0466715_431438 3300042616 Bacteria 35345
120 Ga0466715_629769 3300042616 Bacteria 55391
121 Ga0466726_087810 3300042619 Bacteria 2542
122 Ga0466656_136465 3300042550 Bacteria 11948
123 Ga0466690_340128 3300042590 Bacteria 5951
124 Ga0466691_048331 3300042593 Bacteria 54939
125 Ga0466691_222518 3300042593 Bacteria 8798
126 Ga0466696_005470 3300042596 Bacteria 13020
127 Ga0466706_029968 3300042599 Bacteria 8452
128 Ga0466706_042221 3300042599 Bacteria 2322
129 Ga0466719_135694 3300042606 Bacteria 5218
130 Ga0466704_159910 3300042643 Unclassified 10497
131 Ga0466708_013812 3300042652 Bacteria 17831
132 Ga0466733_000764 3300042659 Bacteria 7249
133 Ga0466715_028768 3300042616 Bacteria 5025
134 Ga0466715_080044 3300042616 Bacteria 13072
135 Ga0466723_015624 3300042618 Bacteria 8596
136 Ga0466728_027424 3300042620 Bacteria 16928
137 Ga0466690_118201 3300042590 Bacteria 5881
138 Ga0466690_320170 3300042590 Unclassified 16684
139 Ga0466691_072496 3300042593 Bacteria 10080
140 Ga0466696_184153 3300042596 Bacteria 23807
141 Ga0466706_028321 3300042599 Bacteria 102705
142 Ga0466714_138662 3300042603 Bacteria 2794
143 Ga0466719_503207 3300042606 Bacteria 13393
144 Ga0466722_041514 3300042609 Bacteria 2538
145 Ga0466722_104828 3300042609 Bacteria 47798
146 Ga0068305_10011075 3300005083 Bacteria 13915
147 Ga0466703_100743 3300042636 Bacteria 8242
148 Ga0466703_108148 3300042636 Bacteria 9948
149 Ga0466704_249708 3300042643 Bacteria 2830
150 Ga0466704_556046 3300042643 Bacteria 110424
151 Ga0466727_104742 3300042655 Bacteria 16342

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_509301 Ga0466711_509301_122_1885 563
2 3300042643 Ga0466704_159910 Ga0466704_159910_655_2769 639
3 3300042590 Ga0466690_043882 Ga0466690_043882_12323_14509 657
4 3300042612 Ga0466705_019972 Ga0466705_019972_240_2354 659
5 3300042615 Ga0466711_463590 Ga0466711_463590_2941_5079 661
6 3300042617 Ga0466718_113134 Ga0466718_113134_14158_16278 663
7 3300042618 Ga0466723_169212 Ga0466723_169212_13179_15365 664
8 3300042596 Ga0466696_457291 Ga0466696_457291_9990_12182 674
9 3300042636 Ga0466703_117837 Ga0466703_117837_2893_5085 674
10 3300042652 Ga0466708_013812 Ga0466708_013812_8825_10927 677
11 3300042643 Ga0466704_196131 Ga0466704_196131_398_2584 682
12 3300042605 Ga0466716_428069 Ga0466716_428069_449_2641 683
13 3300042606 Ga0466719_354122 Ga0466719_354122_37560_39659 686
14 3300042636 Ga0466703_207338 Ga0466703_207338_12_2213 686
15 3300042590 Ga0466690_139114 Ga0466690_139114_51821_53926 688
16 3300042607 Ga0466720_190193 Ga0466720_190193_7155_9314 688
17 3300042616 Ga0466715_521599 Ga0466715_521599_14752_16938 688
18 3300042636 Ga0466703_045500 Ga0466703_045500_8075_10180 688
19 3300002509 JGI24699J35502_11134203 JGI24699J35502_1113420324 690
20 3300042607 Ga0466720_019857 Ga0466720_019857_2345_4534 690
21 3300042607 Ga0466720_124322 Ga0466720_124322_13404_15593 691
22 3300042615 Ga0466711_388295 Ga0466711_388295_20591_22813 691
23 3300042590 Ga0466690_340070 Ga0466690_340070_34_2190 693
24 3300042601 Ga0466707_152657 Ga0466707_152657_20671_22797 693
25 3300042612 Ga0466705_054211 Ga0466705_054211_112_2235 693
26 3300042620 Ga0466728_295496 Ga0466728_295496_59720_61912 694
27 3300042603 Ga0466714_169924 Ga0466714_169924_5559_7790 695
28 3300042654 Ga0466725_048677 Ga0466725_048677_1747_3951 695
29 3300042659 Ga0466733_000764 Ga0466733_000764_3407_5596 695
30 3300042597 Ga0466699_225475 Ga0466699_225475_1550_3721 696
31 3300042652 Ga0466708_241112 Ga0466708_241112_1092_3299 696
32 3300042659 Ga0466733_086329 Ga0466733_086329_8383_10590 696
33 3300042599 Ga0466706_029968 Ga0466706_029968_1598_3799 697
34 3300042616 Ga0466715_135731 Ga0466715_135731_2800_4965 697
35 3300042616 Ga0466715_629769 Ga0466715_629769_46100_48310 699
36 3300042599 Ga0466706_086537 Ga0466706_086537_9502_11703 700
37 3300042602 Ga0466713_020992 Ga0466713_020992_46192_48396 701
38 3300042618 Ga0466723_096641 Ga0466723_096641_846_3026 701
39 3300000062 IMNBL1DRAFT_c0000475 IMNBL1DRAFT_000047519 702
40 3300005083 Ga0068305_10011075 Ga0068305_1001107510 702
41 3300010167 Ga0123353_10000014 Ga0123353_1000001479 702
42 3300042596 Ga0466696_238108 Ga0466696_238108_421_2643 702
43 3300042609 Ga0466722_029980 Ga0466722_029980_723_2927 702
44 3300042655 Ga0466727_292959 Ga0466727_292959_106_2313 702
45 3300042601 Ga0466707_246922 Ga0466707_246922_6466_8673 703
46 3300042643 Ga0466704_035412 Ga0466704_035412_9845_12049 703
47 3300042648 Ga0466709_039622 Ga0466709_039622_1640_3841 704
48 3300042648 Ga0466709_182034 Ga0466709_182034_174_2381 704
49 3300042648 Ga0466709_216689 Ga0466709_216689_27516_29720 704
50 iso_pr_bacteria 2820016619 2820016908 704
51 3300010167 Ga0123353_10165977 Ga0123353_101659773 705
52 3300042596 Ga0466696_184153 Ga0466696_184153_1413_3614 705
53 3300042599 Ga0466706_028321 Ga0466706_028321_27077_29257 705
54 3300042605 Ga0466716_154143 Ga0466716_154143_13916_16120 705
55 iso_pr_bacteria 650716102 650882334 705
56 3300042593 Ga0466691_146428 Ga0466691_146428_1971_4184 706
57 3300042596 Ga0466696_266425 Ga0466696_266425_28049_30238 706
58 3300042616 Ga0466715_297858 Ga0466715_297858_3384_5570 706
59 3300042636 Ga0466703_408191 Ga0466703_408191_7817_10006 706
60 3300042590 Ga0466690_147872 Ga0466690_147872_2561_4765 707
61 3300042605 Ga0466716_086220 Ga0466716_086220_9620_11815 708
62 3300042622 Ga0466731_382687 Ga0466731_382687_4275_6446 708
63 3300042636 Ga0466703_064776 Ga0466703_064776_19343_21565 708
64 3300042596 Ga0466696_115730 Ga0466696_115730_5890_8091 709
65 3300042609 Ga0466722_261554 Ga0466722_261554_13473_15689 709
66 3300042616 Ga0466715_072088 Ga0466715_072088_60577_62781 709
67 3300042599 Ga0466706_058713 Ga0466706_058713_11535_13736 711
68 3300042616 Ga0466715_028768 Ga0466715_028768_10_2223 711
69 3300042620 Ga0466728_261923 Ga0466728_261923_2565_4769 711
70 3300042636 Ga0466703_019944 Ga0466703_019944_1761_3968 711
71 3300042603 Ga0466714_168924 Ga0466714_168924_13177_15399 712
72 3300042609 Ga0466722_041514 Ga0466722_041514_103_2421 712
73 3300042636 Ga0466703_424561 Ga0466703_424561_55067_57250 712
74 3300042652 Ga0466708_026866 Ga0466708_026866_10599_12860 712
75 3300042590 Ga0466690_118201 Ga0466690_118201_2822_5038 713
76 3300042596 Ga0466696_231994 Ga0466696_231994_244_2445 713
77 3300042601 Ga0466707_038954 Ga0466707_038954_156_2375 713
78 3300042604 Ga0466717_098479 Ga0466717_098479_441_2660 713
79 3300042656 Ga0466732_324983 Ga0466732_324983_75_2279 713
80 3300042590 Ga0466690_340128 Ga0466690_340128_2043_4250 714
81 3300042618 Ga0466723_203179 Ga0466723_203179_7436_9649 714
82 3300042636 Ga0466703_233191 Ga0466703_233191_7690_9897 714
83 3300042659 Ga0466733_122810 Ga0466733_122810_10864_13068 714
84 3300042593 Ga0466691_014326 Ga0466691_014326_1800_4007 715
85 iso_pr_bacteria 2781125689 2781426329 715
86 3300042590 Ga0466690_320170 Ga0466690_320170_2982_5168 716
87 3300042643 Ga0466704_418656 Ga0466704_418656_2756_4972 716
88 3300042590 Ga0466690_417680 Ga0466690_417680_3247_5436 717
89 3300042618 Ga0466723_042477 Ga0466723_042477_1127_3316 717
90 3300042643 Ga0466704_249708 Ga0466704_249708_342_2558 717
91 3300042643 Ga0466704_556046 Ga0466704_556046_65148_67337 717
92 3300042648 Ga0466709_108250 Ga0466709_108250_7304_9502 717
93 3300042602 Ga0466713_009751 Ga0466713_009751_1609_3810 718
94 3300042619 Ga0466726_010571 Ga0466726_010571_507_2696 718
95 3300042621 Ga0466729_118941 Ga0466729_118941_591_2816 718
96 3300042655 Ga0466727_052226 Ga0466727_052226_11353_13551 718
97 3300042590 Ga0466690_292648 Ga0466690_292648_4490_6694 719
98 3300042593 Ga0466691_048331 Ga0466691_048331_29458_31659 719
99 3300042609 Ga0466722_104828 Ga0466722_104828_36591_38816 719
100 3300042636 Ga0466703_108148 Ga0466703_108148_5337_7538 719
101 iso_pr_bacteria 2820285501 2820287453 719
102 3300042620 Ga0466728_128920 Ga0466728_128920_12760_14967 720
103 2225789004 2227535714 2228051504 721
104 3300042619 Ga0466726_087810 Ga0466726_087810_291_2498 721
105 3300042659 Ga0466733_092754 Ga0466733_092754_19269_21491 721
106 3300042603 Ga0466714_138662 Ga0466714_138662_43_2313 722
107 3300042618 Ga0466723_103492 Ga0466723_103492_3950_6193 722
108 3300042643 Ga0466704_148253 Ga0466704_148253_66_2276 722
109 3300042652 Ga0466708_204370 Ga0466708_204370_9812_12025 722
110 3300042618 Ga0466723_279912 Ga0466723_279912_7011_9227 723
111 3300042591 Ga0466692_051289 Ga0466692_051289_6284_8500 724
112 3300042596 Ga0466696_005470 Ga0466696_005470_6879_9098 724
113 3300042606 Ga0466719_135694 Ga0466719_135694_2760_4976 724
114 3300042616 Ga0466715_180294 Ga0466715_180294_13923_16139 724
115 3300002450 JGI24695J34938_10011242 JGI24695J34938_100112422 725
116 3300002462 JGI24702J35022_10000346 JGI24702J35022_1000034614 725
117 3300010049 Ga0123356_10012204 Ga0123356_100122045 725
118 3300042596 Ga0466696_426272 Ga0466696_426272_369_2591 725
119 3300042603 Ga0466714_125685 Ga0466714_125685_1248_3470 725
120 3300042659 Ga0466733_004006 Ga0466733_004006_9223_11445 725
121 3300002462 JGI24702J35022_10000563 JGI24702J35022_100005635 726
122 3300002462 JGI24702J35022_10003605 JGI24702J35022_100036057 726
123 3300010167 Ga0123353_10086595 Ga0123353_100865951 726
124 3300042550 Ga0466656_136465 Ga0466656_136465_3743_5959 726
125 3300042606 Ga0466719_503207 Ga0466719_503207_6023_8359 727
126 iso_pr_bacteria 2820831444 2820832259 727
127 3300042590 Ga0466690_345987 Ga0466690_345987_359_2629 728
128 3300042599 Ga0466706_042221 Ga0466706_042221_82_2310 728
129 3300042603 Ga0466714_058710 Ga0466714_058710_104373_106604 728
130 iso_pr_bacteria 3004677695 3004679534 728
131 3300042590 Ga0466690_207162 Ga0466690_207162_12550_14775 729
132 3300042593 Ga0466691_072496 Ga0466691_072496_265_2490 729
133 3300042636 Ga0466703_424595 Ga0466703_424595_106_2352 729
134 3300042609 Ga0466722_185267 Ga0466722_185267_92_2356 730
135 3300042636 Ga0466703_100743 Ga0466703_100743_3021_5303 731
136 3300042622 Ga0466731_266551 Ga0466731_266551_359_2602 732
137 3300042593 Ga0466691_222518 Ga0466691_222518_6282_8522 733
138 3300042604 Ga0466717_022094 Ga0466717_022094_543_2789 734
139 3300010049 Ga0123356_10072728 Ga0123356_100727283 735
140 iso_pr_bacteria 2820288918 2820290254 735
141 3300042655 Ga0466727_104742 Ga0466727_104742_7431_9908 736
142 iso_pr_bacteria 2820781750 2820782010 736
143 iso_pr_bacteria 2940216256 2940217409 736
144 iso_pr_bacteria 3004667792 3004670949 736
145 iso_pr_bacteria 3004672520 3004673935 736
146 3300010049 Ga0123356_10097971 Ga0123356_100979711 737
147 iso_pr_bacteria 2820737921 2820737955 737
148 iso_pr_bacteria 2820757377 2820759817 737
149 iso_pr_bacteria 2820768849 2820769515 739
150 iso_pr_bacteria 2820774381 2820775400 739
151 iso_pr_bacteria 2940239174 2940241497 742
152 iso_pr_bacteria 2940377351 2940377995 742
153 3300042617 Ga0466718_151327 Ga0466718_151327_25065_27473 743
154 3300042659 Ga0466733_190994 Ga0466733_190994_657_3011 748
155 3300042620 Ga0466728_027424 Ga0466728_027424_3589_5895 753
156 3300042599 Ga0466706_068107 Ga0466706_068107_12775_15153 757
157 3300042655 Ga0466727_287908 Ga0466727_287908_118_2634 759
158 3300042596 Ga0466696_371836 Ga0466696_371836_6467_8812 760
159 3300042602 Ga0466713_090562 Ga0466713_090562_555_2915 766
160 3300042615 Ga0466711_449989 Ga0466711_449989_3786_6131 766
161 3300042602 Ga0466713_100430 Ga0466713_100430_2667_5177 767
162 3300042618 Ga0466723_015624 Ga0466723_015624_259_2769 774
163 3300042655 Ga0466727_000346 Ga0466727_000346_26_2551 777
164 3300042616 Ga0466715_080044 Ga0466715_080044_4406_6790 780
165 3300042616 Ga0466715_039960 Ga0466715_039960_27027_29543 782
166 3300042616 Ga0466715_431438 Ga0466715_431438_2623_5130 782
167 iso_pr_bacteria 2820018428 2820019160 785
168 3300042596 Ga0466696_339196 Ga0466696_339196_16023_18527 787
169 iso_pr_bacteria 2894649344 2894652158 799
170 3300042591 Ga0466692_118411 Ga0466692_118411_24047_26656 856
171 iso_pr_bacteria 2820171952 2820171955 918

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03030 H_PPase Inorganic H+ pyrophosphatase 92 845 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.