Protein Family IF04643
Metagenome
Isolate
144
Members
50
Samples
138
Scaffolds
284.15
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_068096|Ga0466692_068096_7120_8112
- Length
- 330 aa
- Sequence
- VALAVPALTGTDQLNVFLSFLDTVLLSRYNDLFNFQNCGGDMDALGYYNGAWGPLDEMTVPMNDRGGYFGDGVYDAACCANRVIFALDEHIDRFFNSAELIGIRLPYSKDELRKTLNDMAAKVDGDELFVYWQATRGTARRNHTFPDCPPNLWIIVKPGTIADIYKKIKLITLEDTRFLHCNIKTLNLIPNIIAAQRAKEAGCYEAVFHRGGVVTECSRSNVHIIKDGKLITHPADNLILPGIARSHLAGACVRLGVPVEERGFTLDELFDADEVITSSTNAFALSAESIDRKPAGGKAPGLLKKIQDEVMREFSGITGWKKSADWRGLV
Sample Types
Isolate
4.2%
Metagenome
95.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.7%
Kalotermitidae
28.6%
Unclassified
10.2%
Blattidae
8.2%
Rhinotermitidae
8.2%
Termopsidae
8.2%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
133
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 4 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 41 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 42 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 45 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 46 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 47 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 50 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | AustNasuHG_c1000014 | 3300000089 | Bacteria | 40235 |
| 2 | Ga0466716_084243 | 3300042605 | Bacteria | 1876 |
| 3 | Ga0466716_186630 | 3300042605 | Bacteria | 2366 |
| 4 | Ga0466722_051449 | 3300042609 | Bacteria | 1591 |
| 5 | Ga0466722_217008 | 3300042609 | Bacteria | 3037 |
| 6 | Ga0466703_002154 | 3300042636 | Bacteria | 8415 |
| 7 | Ga0466704_272849 | 3300042643 | Bacteria | 4047 |
| 8 | Ga0466704_538789 | 3300042643 | Bacteria | 11796 |
| 9 | Ga0466704_595538 | 3300042643 | Bacteria | 11734 |
| 10 | Ga0466708_246011 | 3300042652 | Bacteria | 47079 |
| 11 | Ga0466727_240322 | 3300042655 | Bacteria | 4006 |
| 12 | Ga0466715_105391 | 3300042616 | Bacteria | 2524 |
| 13 | Ga0466715_164363 | 3300042616 | Bacteria | 2720 |
| 14 | Ga0466728_024426 | 3300042620 | Bacteria | 2713 |
| 15 | Ga0466728_065497 | 3300042620 | Bacteria | 8022 |
| 16 | Ga0415639_084611 | 3300038395 | Bacteria | 1372 |
| 17 | Ga0466656_140587 | 3300042550 | Bacteria | 1814 |
| 18 | Ga0466690_405131 | 3300042590 | Bacteria | 6858 |
| 19 | Ga0466696_077297 | 3300042596 | Bacteria | 21213 |
| 20 | Ga0466699_201999 | 3300042597 | Bacteria | 4315 |
| 21 | Ga0466705_371544 | 3300042612 | Bacteria | 9238 |
| 22 | Ga0466707_117293 | 3300042601 | Bacteria | 2135 |
| 23 | Ga0466716_093157 | 3300042605 | Bacteria | 36386 |
| 24 | Ga0466703_046235 | 3300042636 | Unclassified | 2249 |
| 25 | Ga0466703_196983 | 3300042636 | Bacteria | 2621 |
| 26 | Ga0466709_335553 | 3300042648 | Bacteria | 12820 |
| 27 | Ga0466709_358966 | 3300042648 | Bacteria | 1619 |
| 28 | Ga0466723_051092 | 3300042618 | Bacteria | 11897 |
| 29 | Ga0466723_076966 | 3300042618 | Bacteria | 6179 |
| 30 | Ga0264413_151156 | 3300024493 | Bacteria | 1830 |
| 31 | Ga0456237_0001091 | 3300041968 | Unclassified | 4284 |
| 32 | Ga0466692_199955 | 3300042591 | Bacteria | 1750 |
| 33 | Ga0466691_077028 | 3300042593 | Bacteria | 16173 |
| 34 | Ga0466691_096172 | 3300042593 | Bacteria | 3682 |
| 35 | Ga0466691_123829 | 3300042593 | Bacteria | 1832 |
| 36 | Ga0123353_10141320 | 3300010167 | Bacteria | 3856 |
| 37 | JGI24702J35022_10007243 | 3300002462 | Bacteria | 6372 |
| 38 | Ga0072940_1114782 | 3300005200 | Bacteria | 1361 |
| 39 | Ga0466706_197027 | 3300042599 | Bacteria | 23555 |
| 40 | Ga0466707_112151 | 3300042601 | Bacteria | 3348 |
| 41 | Ga0466719_116218 | 3300042606 | Bacteria | 3657 |
| 42 | Ga0466722_089216 | 3300042609 | Bacteria | 6042 |
| 43 | Ga0466703_065154 | 3300042636 | Bacteria | 1011 |
| 44 | Ga0466703_158034 | 3300042636 | Bacteria | 6194 |
| 45 | Ga0466704_003686 | 3300042643 | Bacteria | 5105 |
| 46 | Ga0466727_131061 | 3300042655 | Bacteria | 1048 |
| 47 | Ga0466690_109809 | 3300042590 | Unclassified | 4163 |
| 48 | Ga0466690_134541 | 3300042590 | Bacteria | 2606 |
| 49 | Ga0466692_068096 | 3300042591 | Bacteria | 10233 |
| 50 | Ga0466707_292522 | 3300042601 | Bacteria | 7547 |
| 51 | Ga0466713_036495 | 3300042602 | Bacteria | 64699 |
| 52 | Ga0466722_195556 | 3300042609 | Bacteria | 26028 |
| 53 | Ga0466704_095453 | 3300042643 | Bacteria | 17801 |
| 54 | Ga0466708_119248 | 3300042652 | Bacteria | 7197 |
| 55 | Ga0466715_153106 | 3300042616 | Bacteria | 63495 |
| 56 | Ga0466715_594185 | 3300042616 | Bacteria | 5070 |
| 57 | Ga0466726_166164 | 3300042619 | Bacteria | 1808 |
| 58 | Ga0466690_316358 | 3300042590 | Bacteria | 7984 |
| 59 | Ga0123357_10259175 | 3300009784 | Bacteria | 1842 |
| 60 | Ga0123355_10001603 | 3300009826 | Bacteria | 31578 |
| 61 | Ga0123353_10153407 | 3300010167 | Bacteria | 3675 |
| 62 | Ga0123353_10604702 | 3300010167 | Bacteria | 1566 |
| 63 | Ga0123354_10347095 | 3300010882 | Bacteria | 1329 |
| 64 | Ga0466705_290739 | 3300042612 | Bacteria | 2789 |
| 65 | Ga0068302_10063128 | 3300005071 | Bacteria | 5473 |
| 66 | Ga0466707_377256 | 3300042601 | Bacteria | 3299 |
| 67 | Ga0466719_079085 | 3300042606 | Bacteria | 17873 |
| 68 | Ga0466722_186632 | 3300042609 | Bacteria | 1205 |
| 69 | Ga0466722_233160 | 3300042609 | Bacteria | 2690 |
| 70 | Ga0466698_034022 | 3300042610 | Bacteria | 1141 |
| 71 | Ga0466729_297080 | 3300042621 | Bacteria | 1822 |
| 72 | Ga0466735_218974 | 3300042624 | Bacteria | 2164 |
| 73 | Ga0466703_113881 | 3300042636 | Unclassified | 35758 |
| 74 | Ga0466704_104929 | 3300042643 | Bacteria | 5314 |
| 75 | Ga0466727_335337 | 3300042655 | Bacteria | 1667 |
| 76 | Ga0466723_054405 | 3300042618 | Bacteria | 8843 |
| 77 | Ga0466723_122354 | 3300042618 | Bacteria | 13181 |
| 78 | Ga0466726_182938 | 3300042619 | Unclassified | 30184 |
| 79 | Ga0466726_461642 | 3300042619 | Bacteria | 3439 |
| 80 | Ga0466692_000425 | 3300042591 | Bacteria | 1505 |
| 81 | Ga0466692_190293 | 3300042591 | Bacteria | 2563 |
| 82 | Ga0466691_076434 | 3300042593 | Bacteria | 4944 |
| 83 | Ga0466696_465000 | 3300042596 | Bacteria | 4313 |
| 84 | Ga0123353_10167160 | 3300010167 | Bacteria | 3496 |
| 85 | Ga0123353_10345294 | 3300010167 | Bacteria | 2246 |
| 86 | JGI24698J34947_10003284 | 3300002449 | Bacteria | 8763 |
| 87 | Ga0068305_10821330 | 3300005083 | Bacteria | 1083 |
| 88 | Ga0466729_272197 | 3300042621 | Unclassified | 3129 |
| 89 | Ga0466703_004183 | 3300042636 | Bacteria | 1914 |
| 90 | Ga0466703_066996 | 3300042636 | Bacteria | 8869 |
| 91 | Ga0466703_255156 | 3300042636 | Bacteria | 6468 |
| 92 | Ga0466704_144051 | 3300042643 | Bacteria | 3289 |
| 93 | Ga0466704_415563 | 3300042643 | Bacteria | 8723 |
| 94 | Ga0466708_058700 | 3300042652 | Bacteria | 4941 |
| 95 | Ga0466727_129938 | 3300042655 | Bacteria | 10421 |
| 96 | Ga0466727_253525 | 3300042655 | Bacteria | 1775 |
| 97 | Ga0466723_022055 | 3300042618 | Bacteria | 2025 |
| 98 | Ga0466726_023161 | 3300042619 | Bacteria | 4524 |
| 99 | Ga0466690_344877 | 3300042590 | Unclassified | 2285 |
| 100 | Ga0466692_049176 | 3300042591 | Bacteria | 8628 |
| 101 | Ga0466692_068300 | 3300042591 | Bacteria | 3519 |
| 102 | Ga0466699_224111 | 3300042597 | Bacteria | 5510 |
| 103 | Ga0466732_361065 | 3300042656 | Bacteria | 2327 |
| 104 | Ga0466733_213276 | 3300042659 | Bacteria | 4875 |
| 105 | JGI24702J35022_10008944 | 3300002462 | Bacteria | 5645 |
| 106 | Ga0466719_047262 | 3300042606 | Bacteria | 8351 |
| 107 | Ga0466722_169310 | 3300042609 | Bacteria | 9043 |
| 108 | Ga0466735_191431 | 3300042624 | Bacteria | 3952 |
| 109 | Ga0466709_287197 | 3300042648 | Bacteria | 2122 |
| 110 | Ga0466708_373383 | 3300042652 | Bacteria | 5093 |
| 111 | Ga0466711_195401 | 3300042615 | Bacteria | 76164 |
| 112 | Ga0466715_290160 | 3300042616 | Bacteria | 1264 |
| 113 | Ga0466718_082884 | 3300042617 | Bacteria | 2931 |
| 114 | Ga0466723_276724 | 3300042618 | Bacteria | 3966 |
| 115 | Ga0466726_188260 | 3300042619 | Bacteria | 1954 |
| 116 | Ga0466726_488224 | 3300042619 | Unclassified | 1097 |
| 117 | Ga0466729_147104 | 3300042621 | Unclassified | 2310 |
| 118 | Ga0466690_002788 | 3300042590 | Bacteria | 26421 |
| 119 | Ga0466690_399347 | 3300042590 | Bacteria | 23386 |
| 120 | Ga0466693_110587 | 3300042592 | Bacteria | 7401 |
| 121 | Ga0466691_121566 | 3300042593 | Bacteria | 12477 |
| 122 | Ga0123356_10078989 | 3300010049 | Bacteria | 3107 |
| 123 | Ga0123356_10217581 | 3300010049 | Bacteria | 1964 |
| 124 | Ga0123353_10756818 | 3300010167 | Bacteria | 1351 |
| 125 | Ga0466732_386756 | 3300042656 | Bacteria | 1959 |
| 126 | Ga0466713_100080 | 3300042602 | Bacteria | 2881 |
| 127 | Ga0466713_115343 | 3300042602 | Bacteria | 67413 |
| 128 | Ga0466719_020462 | 3300042606 | Bacteria | 9089 |
| 129 | Ga0466735_080049 | 3300042624 | Bacteria | 3364 |
| 130 | Ga0466703_388172 | 3300042636 | Bacteria | 1399 |
| 131 | Ga0466708_086335 | 3300042652 | Unclassified | 1129 |
| 132 | Ga0466711_096819 | 3300042615 | Bacteria | 18034 |
| 133 | Ga0466726_095837 | 3300042619 | Unclassified | 3554 |
| 134 | Ga0466726_382957 | 3300042619 | Bacteria | 1400 |
| 135 | Ga0466691_015954 | 3300042593 | Bacteria | 2129 |
| 136 | Ga0466691_202984 | 3300042593 | Bacteria | 9154 |
| 137 | Ga0123356_10036459 | 3300010049 | Bacteria | 4593 |
| 138 | Ga0123356_10571743 | 3300010049 | Bacteria | 1293 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042636 | Ga0466703_388172 | Ga0466703_388172_10_762 | 250 |
| 2 | 3300042643 | Ga0466704_095453 | Ga0466704_095453_11489_12283 | 264 |
| 3 | 3300042618 | Ga0466723_076966 | Ga0466723_076966_4697_5494 | 265 |
| 4 | 3300042643 | Ga0466704_415563 | Ga0466704_415563_5475_6272 | 265 |
| 5 | 3300042636 | Ga0466703_065154 | Ga0466703_065154_11_817 | 268 |
| 6 | 3300042655 | Ga0466727_131061 | Ga0466727_131061_12_824 | 270 |
| 7 | 3300042590 | Ga0466690_002788 | Ga0466690_002788_16756_17595 | 279 |
| 8 | 3300042590 | Ga0466690_109809 | Ga0466690_109809_3187_4026 | 279 |
| 9 | 3300042601 | Ga0466707_292522 | Ga0466707_292522_1819_2658 | 279 |
| 10 | 3300042602 | Ga0466713_115343 | Ga0466713_115343_55752_56591 | 279 |
| 11 | 3300042616 | Ga0466715_594185 | Ga0466715_594185_706_1545 | 279 |
| 12 | 3300042618 | Ga0466723_054405 | Ga0466723_054405_3710_4549 | 279 |
| 13 | 3300042619 | Ga0466726_166164 | Ga0466726_166164_337_1176 | 279 |
| 14 | 3300042619 | Ga0466726_488224 | Ga0466726_488224_98_937 | 279 |
| 15 | 3300042643 | Ga0466704_144051 | Ga0466704_144051_1338_2177 | 279 |
| 16 | 3300010049 | Ga0123356_10217581 | Ga0123356_102175812 | 280 |
| 17 | 3300042593 | Ga0466691_121566 | Ga0466691_121566_6975_7817 | 280 |
| 18 | 3300042593 | Ga0466691_202984 | Ga0466691_202984_4488_5330 | 280 |
| 19 | 3300042599 | Ga0466706_197027 | Ga0466706_197027_11891_12733 | 280 |
| 20 | 3300042619 | Ga0466726_182938 | Ga0466726_182938_21526_22368 | 280 |
| 21 | 3300042636 | Ga0466703_066996 | Ga0466703_066996_3605_4447 | 280 |
| 22 | 3300042636 | Ga0466703_255156 | Ga0466703_255156_4683_5525 | 280 |
| 23 | 3300005071 | Ga0068302_10063128 | Ga0068302_100631287 | 281 |
| 24 | 3300010167 | Ga0123353_10153407 | Ga0123353_101534074 | 281 |
| 25 | 3300024493 | Ga0264413_151156 | Ga0264413_1511562 | 281 |
| 26 | 3300042590 | Ga0466690_316358 | Ga0466690_316358_1546_2391 | 281 |
| 27 | 3300042590 | Ga0466690_399347 | Ga0466690_399347_4848_5693 | 281 |
| 28 | 3300042593 | Ga0466691_076434 | Ga0466691_076434_2487_3332 | 281 |
| 29 | 3300042593 | Ga0466691_123829 | Ga0466691_123829_204_1049 | 281 |
| 30 | 3300042596 | Ga0466696_077297 | Ga0466696_077297_641_1486 | 281 |
| 31 | 3300042597 | Ga0466699_201999 | Ga0466699_201999_1713_2558 | 281 |
| 32 | 3300042602 | Ga0466713_036495 | Ga0466713_036495_52458_53303 | 281 |
| 33 | 3300042605 | Ga0466716_084243 | Ga0466716_084243_858_1703 | 281 |
| 34 | 3300042615 | Ga0466711_096819 | Ga0466711_096819_14047_14892 | 281 |
| 35 | 3300042616 | Ga0466715_105391 | Ga0466715_105391_1305_2150 | 281 |
| 36 | 3300042618 | Ga0466723_022055 | Ga0466723_022055_360_1205 | 281 |
| 37 | 3300042618 | Ga0466723_051092 | Ga0466723_051092_10082_10927 | 281 |
| 38 | 3300042619 | Ga0466726_188260 | Ga0466726_188260_509_1354 | 281 |
| 39 | 3300042619 | Ga0466726_461642 | Ga0466726_461642_2583_3428 | 281 |
| 40 | 3300042621 | Ga0466729_147104 | Ga0466729_147104_1193_2038 | 281 |
| 41 | 3300042621 | Ga0466729_272197 | Ga0466729_272197_443_1288 | 281 |
| 42 | 3300042624 | Ga0466735_191431 | Ga0466735_191431_1755_2600 | 281 |
| 43 | 3300042636 | Ga0466703_046235 | Ga0466703_046235_1092_1937 | 281 |
| 44 | 3300042636 | Ga0466703_113881 | Ga0466703_113881_14754_15599 | 281 |
| 45 | 3300042636 | Ga0466703_158034 | Ga0466703_158034_24_869 | 281 |
| 46 | 3300042636 | Ga0466703_196983 | Ga0466703_196983_16_861 | 281 |
| 47 | 3300042643 | Ga0466704_003686 | Ga0466704_003686_4132_4977 | 281 |
| 48 | 3300042643 | Ga0466704_104929 | Ga0466704_104929_2227_3072 | 281 |
| 49 | 3300042652 | Ga0466708_086335 | Ga0466708_086335_222_1067 | 281 |
| 50 | 3300042652 | Ga0466708_246011 | Ga0466708_246011_19068_19913 | 281 |
| 51 | 3300042655 | Ga0466727_240322 | Ga0466727_240322_2344_3189 | 281 |
| 52 | iso_pr_bacteria | 2781125697 | 2781442924 | 281 |
| 53 | 3300002449 | JGI24698J34947_10003284 | JGI24698J34947_100032848 | 282 |
| 54 | 3300002462 | JGI24702J35022_10007243 | JGI24702J35022_100072432 | 282 |
| 55 | 3300002462 | JGI24702J35022_10008944 | JGI24702J35022_100089445 | 282 |
| 56 | 3300042591 | Ga0466692_000425 | Ga0466692_000425_368_1216 | 282 |
| 57 | 3300042591 | Ga0466692_068300 | Ga0466692_068300_1277_2125 | 282 |
| 58 | 3300042591 | Ga0466692_190293 | Ga0466692_190293_1217_2065 | 282 |
| 59 | 3300042591 | Ga0466692_199955 | Ga0466692_199955_173_1021 | 282 |
| 60 | 3300042602 | Ga0466713_100080 | Ga0466713_100080_991_1839 | 282 |
| 61 | 3300042609 | Ga0466722_186632 | Ga0466722_186632_167_1015 | 282 |
| 62 | 3300042609 | Ga0466722_217008 | Ga0466722_217008_1691_2539 | 282 |
| 63 | 3300042610 | Ga0466698_034022 | Ga0466698_034022_66_914 | 282 |
| 64 | 3300042612 | Ga0466705_290739 | Ga0466705_290739_1598_2446 | 282 |
| 65 | 3300042620 | Ga0466728_065497 | Ga0466728_065497_3304_4152 | 282 |
| 66 | 3300042652 | Ga0466708_373383 | Ga0466708_373383_661_1509 | 282 |
| 67 | 3300042655 | Ga0466727_253525 | Ga0466727_253525_381_1229 | 282 |
| 68 | 3300042655 | Ga0466727_335337 | Ga0466727_335337_262_1110 | 282 |
| 69 | 3300042659 | Ga0466733_213276 | Ga0466733_213276_1681_2529 | 282 |
| 70 | 3300000089 | AustNasuHG_c1000014 | AustNasuHG_100001430 | 283 |
| 71 | 3300005083 | Ga0068305_10821330 | Ga0068305_108213301 | 283 |
| 72 | 3300005200 | Ga0072940_1114782 | Ga0072940_11147822 | 283 |
| 73 | 3300042606 | Ga0466719_079085 | Ga0466719_079085_2979_3830 | 283 |
| 74 | 3300042609 | Ga0466722_089216 | Ga0466722_089216_3620_4471 | 283 |
| 75 | 3300042616 | Ga0466715_153106 | Ga0466715_153106_43843_44694 | 283 |
| 76 | 3300042616 | Ga0466715_290160 | Ga0466715_290160_376_1227 | 283 |
| 77 | 3300010882 | Ga0123354_10347095 | Ga0123354_103470952 | 284 |
| 78 | 3300042590 | Ga0466690_344877 | Ga0466690_344877_488_1342 | 284 |
| 79 | 3300042593 | Ga0466691_015954 | Ga0466691_015954_1207_2061 | 284 |
| 80 | 3300042605 | Ga0466716_093157 | Ga0466716_093157_164_1018 | 284 |
| 81 | 3300042643 | Ga0466704_595538 | Ga0466704_595538_245_1099 | 284 |
| 82 | 3300042652 | Ga0466708_058700 | Ga0466708_058700_1563_2417 | 284 |
| 83 | 3300009784 | Ga0123357_10259175 | Ga0123357_102591752 | 285 |
| 84 | 3300010049 | Ga0123356_10571743 | Ga0123356_105717432 | 285 |
| 85 | 3300042550 | Ga0466656_140587 | Ga0466656_140587_25_882 | 285 |
| 86 | 3300042591 | Ga0466692_049176 | Ga0466692_049176_5160_6017 | 285 |
| 87 | 3300042606 | Ga0466719_047262 | Ga0466719_047262_4493_5350 | 285 |
| 88 | 3300010049 | Ga0123356_10036459 | Ga0123356_100364593 | 286 |
| 89 | 3300010167 | Ga0123353_10141320 | Ga0123353_101413204 | 286 |
| 90 | 3300010167 | Ga0123353_10604702 | Ga0123353_106047021 | 286 |
| 91 | 3300042590 | Ga0466690_134541 | Ga0466690_134541_1217_2077 | 286 |
| 92 | 3300042592 | Ga0466693_110587 | Ga0466693_110587_303_1163 | 286 |
| 93 | 3300042593 | Ga0466691_077028 | Ga0466691_077028_7315_8175 | 286 |
| 94 | 3300042605 | Ga0466716_186630 | Ga0466716_186630_1244_2104 | 286 |
| 95 | 3300042606 | Ga0466719_020462 | Ga0466719_020462_2543_3451 | 286 |
| 96 | 3300042609 | Ga0466722_051449 | Ga0466722_051449_717_1577 | 286 |
| 97 | 3300042616 | Ga0466715_164363 | Ga0466715_164363_1533_2393 | 286 |
| 98 | 3300042617 | Ga0466718_082884 | Ga0466718_082884_1323_2183 | 286 |
| 99 | 3300042620 | Ga0466728_024426 | Ga0466728_024426_934_1794 | 286 |
| 100 | 3300042621 | Ga0466729_297080 | Ga0466729_297080_497_1357 | 286 |
| 101 | 3300042624 | Ga0466735_218974 | Ga0466735_218974_610_1470 | 286 |
| 102 | 3300042648 | Ga0466709_358966 | Ga0466709_358966_296_1156 | 286 |
| 103 | 3300042652 | Ga0466708_119248 | Ga0466708_119248_3638_4498 | 286 |
| 104 | 3300042656 | Ga0466732_361065 | Ga0466732_361065_752_1612 | 286 |
| 105 | 3300042656 | Ga0466732_386756 | Ga0466732_386756_863_1723 | 286 |
| 106 | iso_pr_bacteria | 2781125639 | 2781286001 | 286 |
| 107 | iso_pr_bacteria | 2940264388 | 2940264575 | 286 |
| 108 | iso_pr_bacteria | 2940267548 | 2940267648 | 286 |
| 109 | iso_pr_bacteria | 2940270707 | 2940270807 | 286 |
| 110 | iso_pr_bacteria | 2940273867 | 2940274054 | 286 |
| 111 | 3300042593 | Ga0466691_096172 | Ga0466691_096172_2657_3520 | 287 |
| 112 | 3300042609 | Ga0466722_195556 | Ga0466722_195556_7232_8095 | 287 |
| 113 | 3300042609 | Ga0466722_233160 | Ga0466722_233160_327_1190 | 287 |
| 114 | 3300042618 | Ga0466723_122354 | Ga0466723_122354_3335_4198 | 287 |
| 115 | 3300042636 | Ga0466703_002154 | Ga0466703_002154_6789_7652 | 287 |
| 116 | 3300010167 | Ga0123353_10345294 | Ga0123353_103452941 | 288 |
| 117 | 3300042601 | Ga0466707_117293 | Ga0466707_117293_62_928 | 288 |
| 118 | 3300042612 | Ga0466705_371544 | Ga0466705_371544_20_1027 | 288 |
| 119 | 3300042618 | Ga0466723_276724 | Ga0466723_276724_1262_2128 | 288 |
| 120 | 3300042619 | Ga0466726_023161 | Ga0466726_023161_881_1747 | 288 |
| 121 | 3300042619 | Ga0466726_095837 | Ga0466726_095837_2000_2866 | 288 |
| 122 | 3300042619 | Ga0466726_382957 | Ga0466726_382957_285_1151 | 288 |
| 123 | 3300041968 | Ga0456237_0001091 | Ga0456237_0001091_932_1801 | 289 |
| 124 | 3300042590 | Ga0466690_405131 | Ga0466690_405131_927_1796 | 289 |
| 125 | 3300042601 | Ga0466707_112151 | Ga0466707_112151_1762_2631 | 289 |
| 126 | 3300042624 | Ga0466735_080049 | Ga0466735_080049_896_1765 | 289 |
| 127 | 3300042643 | Ga0466704_272849 | Ga0466704_272849_380_1249 | 289 |
| 128 | 3300042655 | Ga0466727_129938 | Ga0466727_129938_164_1033 | 289 |
| 129 | 3300038395 | Ga0415639_084611 | Ga0415639_084611_405_1277 | 290 |
| 130 | 3300042597 | Ga0466699_224111 | Ga0466699_224111_2577_3449 | 290 |
| 131 | 3300042615 | Ga0466711_195401 | Ga0466711_195401_8436_9311 | 291 |
| 132 | 3300042648 | Ga0466709_287197 | Ga0466709_287197_796_1671 | 291 |
| 133 | 3300010167 | Ga0123353_10167160 | Ga0123353_101671605 | 292 |
| 134 | 3300042609 | Ga0466722_169310 | Ga0466722_169310_8040_8918 | 292 |
| 135 | 3300042596 | Ga0466696_465000 | Ga0466696_465000_2556_3437 | 293 |
| 136 | 3300042601 | Ga0466707_377256 | Ga0466707_377256_1345_2229 | 294 |
| 137 | 3300042643 | Ga0466704_538789 | Ga0466704_538789_10680_11606 | 295 |
| 138 | 3300010167 | Ga0123353_10756818 | Ga0123353_107568182 | 296 |
| 139 | 3300042606 | Ga0466719_116218 | Ga0466719_116218_2021_2911 | 296 |
| 140 | 3300010049 | Ga0123356_10078989 | Ga0123356_100789891 | 299 |
| 141 | 3300042636 | Ga0466703_004183 | Ga0466703_004183_145_1062 | 305 |
| 142 | 3300042648 | Ga0466709_335553 | Ga0466709_335553_3870_4787 | 305 |
| 143 | 3300009826 | Ga0123355_10001603 | Ga0123355_1000160319 | 308 |
| 144 | 3300042591 | Ga0466692_068096 | Ga0466692_068096_7120_8112 | 330 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01063 | Aminotran_4 | Amino-transferase class IV | 72 | 281 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01063 | GO:0003824 | catalytic activity | MF |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4daa-assembly1.cif.gz_A | CRYSTALLOGRAPHIC STRUCTURE OF D-AMINO ACID AMINOTRANSFERASE IN PYRIDOXAL-5'-PHOSPHATE (PLP) FORM | 0.916 | 45 | 309 |
| 5daa-assembly1.cif.gz_B | E177K MUTANT OF D-AMINO ACID AMINOTRANSFERASE COMPLEXED WITH PYRIDOXAMINE-5'-PHOSPHATE | 0.915 | 45 | 309 |
| 1g2w-assembly1.cif.gz_B | E177S MUTANT OF THE PYRIDOXAL-5'-PHOSPHATE ENZYME D-AMINO ACID AMINOTRANSFERASE | 0.909 | 45 | 309 |
| 4tm5-assembly1.cif.gz_A-2 | X-ray crystal structure of a D-amino acid aminotransferase from Burkholderia thailandensis E264 bound to the co-factor pyridoxal phosphate | 0.907 | 43 | 316 |
| 2dab-assembly1.cif.gz_A | L201A MUTANT OF D-AMINO ACID AMINOTRANSFERASE COMPLEXED WITH PYRIDOXAL-5'-PHOSPHATE | 0.896 | 45 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5cm0C01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9377 | 45 | 159 | 3.30.470.10 |
| af_Q2FXI0_1_119_3.30.470.10 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9324 | 45 | 159 | 3.30.470.10 |
| 1a0gA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9131 | 45 | 159 | 3.30.470.10 |
| 4pbcA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9113 | 44 | 159 | 3.30.470.10 |
| 4pbcB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9105 | 187 | 316 | 3.20.10.10 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.75 | 0.78 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.