Protein Family IF04641

Metagenome Isolate
162 Members
119 Samples
106 Scaffolds
209.18 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_063852|Ga0466692_063852_18247_18939
Length
230 aa
Sequence
MAVEKRESFVIDWQRKIMEKFTALTGLVAPLDRSNIDTDAIIPKQFLKSIKRSGFGVNAFDEWRYLDHGEPGMDNRSRPLNPNFVLNQERYRGASILLVRANFGCGSSREHAPWALVDYGFKVILAESFADIFFNNSFKNGLLPLVLPRAEIDALFALVEAAPGFSLAVDLAAQTLTRPDGYVISFPVDLFRKECLLNGWDDIGLTLRHTDEIRAFEERRRAEQPWLFPA

📊 Sample Types

Isolate 34.6%
Metagenome 65.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 18.1%
Unclassified 16.4%
Coreidae 12.9%
Kalotermitidae 11.2%
Formicidae 10.3%
Elmidae 6.0%
Culicidae 5.2%
Aphididae 3.4%
Rhinotermitidae 3.4%
Largidae 1.7%
Blattidae 1.7%
Drosophilidae 1.7%
Noctuidae 0.9%
Cerambycidae 0.9%
Curculionidae 0.9%
Berytidae 0.9%
Pediculidae 0.9%
Termopsidae 0.9%
Passalidae 0.9%
Pseudococcidae 0.9%
Hodotermitidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2603880164 Opitutus sp. Isolate Formicidae
2 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
3 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
4 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
5 8102145433 Caballeronia sp. LP006 Isolate Coreidae
6 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
7 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
10 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
11 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
12 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
13 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
14 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
15 2884492481 Buchnera aphidicola BuCicurtihirsuta/3053 Isolate Aphididae
16 2884492905 Buchnera aphidicola BuCipiceae/3303 Isolate Aphididae
17 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
18 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
26 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
27 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 2524614573 Marinospirillum minutulum DSM 6287 Isolate Unclassified
30 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
31 2864874997 Acinetobacter lwoffii S00127 Isolate Elmidae
32 2841132873 Buchnera aphidicola BTs Pazieg Isolate Aphididae
33 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
34 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
35 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
36 8023757577 Caballeronia peredens LP006 Isolate Coreidae
37 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
38 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
39 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
40 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
41 2531839311 Acinetobacter sp. HA Isolate Noctuidae
42 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
43 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
44 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
45 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
46 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
47 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
49 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
50 3300009471 Microbial communities of aphids from galls on Rhus javanica in Mt Takao, Hachioji, Japan - Schlechtendalia chinensis CVD94-71 seqcov Metagenome
51 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
52 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
53 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
54 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
55 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
56 2864973726 Acinetobacter schindleri S00243 Isolate Elmidae
57 2884498641 Buchnera aphidicola BuCicurvipes/3402 Isolate Aphididae
58 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
59 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
60 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
61 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
62 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
63 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
64 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
65 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
66 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
67 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
68 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
69 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
70 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
71 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
72 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
73 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
74 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
75 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
76 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
77 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
78 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
79 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
80 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
81 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
82 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
83 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
84 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
85 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
86 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
87 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
88 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
89 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
90 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
91 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
92 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
93 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
94 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
95 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
96 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
97 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
98 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
99 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
100 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
101 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
102 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
103 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
104 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
105 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
106 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
107 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
108 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
109 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
110 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
111 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
112 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
113 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
114 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
115 650716018 Candidatus Tremblaya princeps PCIT Isolate Pseudococcidae
116 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
117 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
118 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
119 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_012404 3300042612 Unclassified 2074
2 Ga0160446_100297 3300012835 Bacteria 29144
3 Ga0466657_047577 3300042582 Bacteria 20534
4 Ga0466691_077588 3300042593 Bacteria 24167
5 Ga0466707_373362 3300042601 Bacteria 8557
6 Ga0466713_140799 3300042602 Bacteria 19248
7 Ga0466722_051357 3300042609 Bacteria 3271
8 Ga0466702_456782 3300042635 Bacteria 4086
9 AglaG_contig01883 2084038013 Bacteria 1171
10 Ga0103264_1000304 3300007188 Bacteria 27092
11 Ga0105005_1037987 3300007505 Bacteria 6781
12 Ga0466710_381390 3300042613 Bacteria 32855
13 Ga0160460_102977 3300012845 Bacteria 3293
14 Ga0466690_292632 3300042590 Bacteria 16499
15 Ga0466706_116404 3300042599 Bacteria 2886
16 Ga0466713_012784 3300042602 Bacteria 1400
17 Ga0466713_034647 3300042602 Bacteria 26025
18 Ga0123353_10013509 3300010167 Bacteria 11702
19 Ga0466725_037252 3300042654 Bacteria 45444
20 Ga0466725_385790 3300042654 Bacteria 2867
21 JGI24702J35022_10000310 3300002462 Bacteria 28806
22 Ga0072941_1318341 3300005201 Bacteria 3835
23 Ga0102737_1000363 3300007142 Bacteria 15330
24 Ga0127653_100120 3300009471 Bacteria 188812
25 Ga0123357_10000285 3300009784 Bacteria 48399
26 Ga0466718_003567 3300042617 Bacteria 3336
27 Ga0466723_204311 3300042618 Bacteria 16096
28 Ga0466690_117806 3300042590 Bacteria 8895
29 Ga0466707_023685 3300042601 Bacteria 19427
30 Ga0466716_548766 3300042605 Bacteria 4052
31 Ga0466719_071789 3300042606 Bacteria 5803
32 Ga0466734_040544 3300042623 Bacteria 2338
33 Ga0466724_08031 3300042649 Bacteria 72239
34 Ga0466708_175810 3300042652 Bacteria 81328
35 IMNBGM34_c000918 3300000036 Bacteria 6408
36 JGI24695J34938_10232701 3300002450 Bacteria 777
37 Ga0103266_1000038 3300007067 Bacteria 205800
38 Ga0466729_155179 3300042621 Bacteria 91460
39 Ga0466692_024378 3300042591 Bacteria 43078
40 Ga0466692_077892 3300042591 Bacteria 7673
41 Ga0466719_393880 3300042606 Bacteria 2137
42 Ga0466698_359320 3300042610 Bacteria 1127
43 Ga0123355_10955712 3300009826 Bacteria 919
44 Ga0123356_10020901 3300010049 Bacteria 6191
45 Ga0123356_10170998 3300010049 Bacteria 2183
46 Ga0123354_10234811 3300010882 Bacteria 1906
47 Ga0466730_102983 3300042625 Unclassified 1035
48 Ga0466703_021322 3300042636 Bacteria 7887
49 Ga0466703_412632 3300042636 Bacteria 4408
50 Ga0466704_258426 3300042643 Bacteria 95131
51 CVPL005L_10000102 3300002938 Bacteria 62025
52 Ga0466733_129929 3300042659 Bacteria 2136
53 Ga0160459_100150 3300012831 Bacteria 40128
54 Ga0466657_034180 3300042582 Bacteria 1271
55 Ga0466657_390823 3300042582 Bacteria 58911
56 Ga0466690_134399 3300042590 Bacteria 25770
57 Ga0123353_10799091 3300010167 Bacteria 1303
58 Ga0466730_062864 3300042625 Bacteria 13200
59 Ga0466724_35102 3300042649 Bacteria 4882
60 Ga0466708_064045 3300042652 Bacteria 19560
61 Ga0466708_355353 3300042652 Bacteria 40735
62 Ga0466725_407998 3300042654 Bacteria 13599
63 CVPL010W_10000025 3300002931 Bacteria 82116
64 Ga0102735_1000037 3300007080 Bacteria 61745
65 Ga0102737_1000219 3300007142 Bacteria 19343
66 Ga0103268_1000431 3300007192 Bacteria 24715
67 Ga0466705_087780 3300042612 Bacteria 84355
68 Ga0466732_278187 3300042656 Bacteria 3568
69 Ga0466712_043328 3300042614 Bacteria 3883
70 Ga0466711_275509 3300042615 Bacteria 1934
71 Ga0160458_105062 3300012832 Bacteria 1579
72 Ga0160460_100348 3300012845 Bacteria 31946
73 Ga0466657_142224 3300042582 Bacteria 5844
74 Ga0466707_186237 3300042601 Unclassified 7567
75 Ga0123353_10032635 3300010167 Bacteria 8090
76 Ga0123353_10121533 3300010167 Bacteria 4199
77 Ga0466734_092086 3300042623 Bacteria 5203
78 Ga0103261_1000023 3300007083 Bacteria 256806
79 Ga0102739_1000028 3300007095 Bacteria 90454
80 Ga0102734_1000743 3300007129 Bacteria 8841
81 Ga0104019_1002043 3300007150 Bacteria 2941
82 Ga0104019_1004714 3300007150 Bacteria 5990
83 Ga0466711_234910 3300042615 Bacteria 1463
84 Ga0466715_316385 3300042616 Bacteria 19410
85 Ga0160470_107637 3300012813 Unclassified 1149
86 Ga0123354_10000381 3300010882 Bacteria 42382
87 Ga0123354_10506209 3300010882 Bacteria 938
88 Ga0466704_485277 3300042643 Bacteria 2853
89 IMNBGM34_c004043 3300000036 Bacteria 2001
90 JGI24702J35022_10024622 3300002462 Bacteria 3251
91 JGI24705J35276_12235422 3300002504 Bacteria 6515
92 Ga0466710_038761 3300042613 Bacteria 64329
93 Ga0466710_152128 3300042613 Bacteria 28408
94 Ga0466723_002341 3300042618 Bacteria 3500
95 Ga0466728_337367 3300042620 Bacteria 7312
96 Ga0466657_135704 3300042582 Bacteria 8965
97 Ga0466657_347002 3300042582 Bacteria 3899
98 Ga0466692_063852 3300042591 Bacteria 48253
99 Ga0466691_026404 3300042593 Bacteria 5995
100 Ga0160454_100143 3300012798 Bacteria 86289
101 Ga0466709_197804 3300042648 Bacteria 5881
102 Ga0466724_26794 3300042649 Bacteria 2684
103 Ga0466708_257858 3300042652 Bacteria 11355
104 Ga0466727_203749 3300042655 Bacteria 45935
105 JGI24702J35022_10024872 3300002462 Bacteria 3233
106 Ga0102736_1000060 3300007052 Bacteria 100494

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000036 IMNBGM34_c000918 IMNBGM34_0009186 187
2 3300007192 Ga0103268_1000431 Ga0103268_100043113 189
3 3300042613 Ga0466710_152128 Ga0466710_152128_19215_19802 195
4 3300042615 Ga0466711_275509 Ga0466711_275509_1151_1738 195
5 3300042652 Ga0466708_175810 Ga0466708_175810_50738_51325 195
6 3300010167 Ga0123353_10121533 Ga0123353_101215332 197
7 3300010167 Ga0123353_10799091 Ga0123353_107990912 197
8 3300009826 Ga0123355_10955712 Ga0123355_109557122 199
9 3300042602 Ga0466713_140799 Ga0466713_140799_17579_18181 200
10 iso_pr_bacteria 2841132873 2841133290 200
11 3300042610 Ga0466698_359320 Ga0466698_359320_434_1039 201
12 3300042636 Ga0466703_412632 Ga0466703_412632_3199_3804 201
13 iso_pr_bacteria 2517572100 2517758471 201
14 iso_pr_bacteria 2603880164 2606012692 201
15 iso_pr_bacteria 2639763185 2642343819 201
16 iso_pr_bacteria 2639763186 2642348563 201
17 iso_pr_bacteria 2857493320 2857493723 201
18 iso_pr_bacteria 2857498920 2857499726 201
19 iso_pr_bacteria 2940239174 2940241808 201
20 iso_pr_bacteria 2940377351 2940379965 201
21 3300002938 CVPL005L_10000102 CVPL005L_1000010235 202
22 3300007052 Ga0102736_1000060 Ga0102736_100006020 202
23 3300007067 Ga0103266_1000038 Ga0103266_1000038143 202
24 3300007083 Ga0103261_1000023 Ga0103261_1000023182 202
25 3300007095 Ga0102739_1000028 Ga0102739_100002860 202
26 3300007142 Ga0102737_1000219 Ga0102737_10002197 202
27 3300007142 Ga0102737_1000363 Ga0102737_10003637 202
28 3300010882 Ga0123354_10506209 Ga0123354_105062091 202
29 3300012813 Ga0160470_107637 Ga0160470_1076372 202
30 3300012845 Ga0160460_102977 Ga0160460_1029772 202
31 3300042609 Ga0466722_051357 Ga0466722_051357_590_1198 202
32 3300042612 Ga0466705_012404 Ga0466705_012404_426_1034 202
33 iso_pr_bacteria 2508501067 2508836025 202
34 iso_pr_bacteria 2706794701 2708048757 202
35 iso_pr_bacteria 650716018 651012570 202
36 3300000036 IMNBGM34_c004043 IMNBGM34_0040432 203
37 3300002931 CVPL010W_10000025 CVPL010W_1000002517 203
38 3300007129 Ga0102734_1000743 Ga0102734_10007437 203
39 3300009471 Ga0127653_100120 Ga0127653_100120139 204
40 3300012835 Ga0160446_100297 Ga0160446_10029719 204
41 3300012845 Ga0160460_100348 Ga0160460_10034810 204
42 iso_pr_bacteria 2619619079 2620605408 204
43 iso_pr_bacteria 2884492481 2884492897 204
44 iso_pr_bacteria 3003869270 3003876057 204
45 iso_pr_bacteria 3003878002 3003886428 204
46 iso_pr_bacteria 8023724303 8023724687 204
47 iso_pr_bacteria 8023757577 8023757961 204
48 iso_pr_bacteria 8023764196 8023772488 204
49 iso_pr_bacteria 8024001094 8024006556 204
50 iso_pr_bacteria 8024044713 8024049022 204
51 iso_pr_bacteria 8025747911 8025751252 204
52 iso_pr_bacteria 8025756023 8025759364 204
53 iso_pr_bacteria 8069755105 8069758446 204
54 iso_pr_bacteria 8102041249 8102046862 204
55 iso_pr_bacteria 8102060671 8102066896 204
56 iso_pr_bacteria 8102074813 8102080718 204
57 iso_pr_bacteria 8102081745 8102086663 204
58 iso_pr_bacteria 8102087471 8102093641 204
59 iso_pr_bacteria 8102145433 8102145817 204
60 iso_pr_bacteria 8102152052 8102160344 204
61 iso_pr_bacteria 8102161003 8102161350 204
62 3300042643 Ga0466704_485277 Ga0466704_485277_2140_2757 205
63 iso_pr_bacteria 2884492905 2884493320 205
64 iso_pr_bacteria 2884498641 2884499056 205
65 3300042659 Ga0466733_129929 Ga0466733_129929_119_739 206
66 3300007188 Ga0103264_1000304 Ga0103264_100030422 208
67 3300007080 Ga0102735_1000037 Ga0102735_100003724 210
68 3300042599 Ga0466706_116404 Ga0466706_116404_1560_2195 211
69 3300042606 Ga0466719_071789 Ga0466719_071789_2992_3627 211
70 3300005201 Ga0072941_1318341 Ga0072941_13183413 212
71 3300012831 Ga0160459_100150 Ga0160459_1001508 212
72 3300042590 Ga0466690_134399 Ga0466690_134399_4008_4646 212
73 3300042593 Ga0466691_077588 Ga0466691_077588_23081_23719 212
74 3300042602 Ga0466713_012784 Ga0466713_012784_440_1078 212
75 3300042605 Ga0466716_548766 Ga0466716_548766_1622_2260 212
76 3300042606 Ga0466719_393880 Ga0466719_393880_95_733 212
77 3300042615 Ga0466711_234910 Ga0466711_234910_67_705 212
78 3300042618 Ga0466723_002341 Ga0466723_002341_398_1036 212
79 3300042620 Ga0466728_337367 Ga0466728_337367_4301_4939 212
80 3300042652 Ga0466708_064045 Ga0466708_064045_785_1423 212
81 3300042652 Ga0466708_355353 Ga0466708_355353_28060_28698 212
82 3300042654 Ga0466725_385790 Ga0466725_385790_176_814 212
83 iso_pr_bacteria 2524614573 2524998814 212
84 3300042582 Ga0466657_034180 Ga0466657_034180_498_1139 213
85 3300042582 Ga0466657_047577 Ga0466657_047577_17484_18125 213
86 3300042582 Ga0466657_135704 Ga0466657_135704_3341_3982 213
87 3300042582 Ga0466657_347002 Ga0466657_347002_1337_1978 213
88 3300042582 Ga0466657_390823 Ga0466657_390823_25528_26169 213
89 3300042590 Ga0466690_117806 Ga0466690_117806_2100_2741 213
90 3300042590 Ga0466690_292632 Ga0466690_292632_14068_14709 213
91 3300042591 Ga0466692_024378 Ga0466692_024378_40442_41083 213
92 3300042591 Ga0466692_077892 Ga0466692_077892_3939_4580 213
93 3300042593 Ga0466691_026404 Ga0466691_026404_2944_3585 213
94 3300042601 Ga0466707_023685 Ga0466707_023685_8784_9425 213
95 3300042601 Ga0466707_186237 Ga0466707_186237_348_989 213
96 3300042601 Ga0466707_373362 Ga0466707_373362_1945_2586 213
97 3300042602 Ga0466713_034647 Ga0466713_034647_20944_21585 213
98 3300042612 Ga0466705_087780 Ga0466705_087780_61017_61658 213
99 3300042613 Ga0466710_038761 Ga0466710_038761_46225_46866 213
100 3300042613 Ga0466710_381390 Ga0466710_381390_23911_24552 213
101 3300042614 Ga0466712_043328 Ga0466712_043328_1206_1847 213
102 3300042616 Ga0466715_316385 Ga0466715_316385_6619_7260 213
103 3300042618 Ga0466723_204311 Ga0466723_204311_7434_8075 213
104 3300042621 Ga0466729_155179 Ga0466729_155179_44500_45141 213
105 3300042623 Ga0466734_092086 Ga0466734_092086_2306_2947 213
106 3300042635 Ga0466702_456782 Ga0466702_456782_206_847 213
107 3300042636 Ga0466703_021322 Ga0466703_021322_5856_6497 213
108 3300042643 Ga0466704_258426 Ga0466704_258426_70889_71530 213
109 3300042654 Ga0466725_037252 Ga0466725_037252_6162_6803 213
110 3300042654 Ga0466725_407998 Ga0466725_407998_4763_5404 213
111 3300042655 Ga0466727_203749 Ga0466727_203749_24657_25298 213
112 iso_pr_bacteria 2820042117 2820042511 213
113 iso_pr_bacteria 2820050117 2820050768 213
114 iso_pr_bacteria 2820062699 2820063403 213
115 iso_pr_bacteria 2820065746 2820066405 213
116 iso_pr_bacteria 2820084079 2820085918 213
117 iso_pr_bacteria 2820086750 2820089232 213
118 iso_pr_bacteria 2820089333 2820089908 213
119 iso_pr_bacteria 2820121232 2820121707 213
120 iso_pr_bacteria 2820132692 2820133147 213
121 iso_pr_bacteria 2820152154 2820153180 213
122 3300002450 JGI24695J34938_10232701 JGI24695J34938_102327011 214
123 3300002462 JGI24702J35022_10000310 JGI24702J35022_100003103 214
124 3300002462 JGI24702J35022_10024622 JGI24702J35022_100246223 214
125 3300002462 JGI24702J35022_10024872 JGI24702J35022_100248723 214
126 3300002504 JGI24705J35276_12235422 JGI24705J35276_122354221 214
127 3300009784 Ga0123357_10000285 Ga0123357_1000028524 214
128 3300010049 Ga0123356_10020901 Ga0123356_100209017 214
129 3300010049 Ga0123356_10170998 Ga0123356_101709982 214
130 3300010167 Ga0123353_10013509 Ga0123353_1001350913 214
131 3300010167 Ga0123353_10032635 Ga0123353_100326356 214
132 3300010882 Ga0123354_10000381 Ga0123354_1000038111 214
133 3300010882 Ga0123354_10234811 Ga0123354_102348112 214
134 3300012798 Ga0160454_100143 Ga0160454_10014386 214
135 3300012832 Ga0160458_105062 Ga0160458_1050622 215
136 3300042623 Ga0466734_040544 Ga0466734_040544_121_768 215
137 3300042625 Ga0466730_062864 Ga0466730_062864_6153_6800 215
138 3300042625 Ga0466730_102983 Ga0466730_102983_79_726 215
139 3300042649 Ga0466724_08031 Ga0466724_08031_25196_25843 215
140 3300042656 Ga0466732_278187 Ga0466732_278187_2448_3095 215
141 iso_pr_bacteria 641522603 641585240 215
142 2084038013 AglaG_contig01883 AglaG_04190900 216
143 3300042648 Ga0466709_197804 Ga0466709_197804_5120_5770 216
144 3300042649 Ga0466724_26794 Ga0466724_26794_100_750 216
145 3300042649 Ga0466724_35102 Ga0466724_35102_1507_2157 216
146 iso_pr_bacteria 2531839311 2533038575 216
147 iso_pr_bacteria 2864804954 2864805939 216
148 iso_pr_bacteria 2864840607 2864840760 216
149 iso_pr_bacteria 2864843793 2864845141 216
150 iso_pr_bacteria 2864863795 2864863977 216
151 iso_pr_bacteria 2864874997 2864875967 216
152 iso_pr_bacteria 2864973726 2864975750 216
153 iso_pr_bacteria 3006190525 3006191623 216
154 iso_pr_bacteria 8021899934 8021902861 216
155 3300007150 Ga0104019_1002043 Ga0104019_10020433 217
156 3300007150 Ga0104019_1004714 Ga0104019_10047143 217
157 3300007505 Ga0105005_1037987 Ga0105005_10379873 217
158 3300042652 Ga0466708_257858 Ga0466708_257858_2838_3497 219
159 3300042582 Ga0466657_142224 Ga0466657_142224_4506_5171 221
160 iso_pr_bacteria 2864826666 2864829359 224
161 3300042617 Ga0466718_003567 Ga0466718_003567_492_1181 229
162 3300042591 Ga0466692_063852 Ga0466692_063852_18247_18939 230

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00694 Aconitase_C Aconitase C-terminal domain 18 149 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.