Protein Family IF04627

Metagenome Isolate
141 Members
78 Samples
126 Scaffolds
311.96 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_040365|Ga0466692_040365_42420_43394
Length
324 aa
Sequence
MSDGTMTLSAFSGTRRALICGSLAYDHIMIFQDRFKNHILPEKIHVLNVAFLVPEMRREFGGCAGNIAYGLRLLGETPHVMATVGEDFAPYRERLTRLGLPLARIRQIPGTFTAQAFITTDLDDNQITAFHPGAMSRSHENRIAAGDAELGIVAPDGRDGMLGHARDFSAAGIPFIFDPGQGLPMFSGEELLEFLELAEYACFNDYEINLASERTGLSTERLAERVAALIVTRGGEGSLIYAGGTRLEIPCAPARALVDPTGCGDAYRAGLLYGLLHEFDWRKAGQLASLMGALKIEHPGPQNYAPSREEIAARYAEAFGDRLF

📊 Sample Types

Isolate 10.6%
Metagenome 89.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Formicidae 18.9%
Termitidae 17.6%
Kalotermitidae 16.2%
Unclassified 12.2%
Armadillidiidae 9.5%
Culicidae 8.1%
Elmidae 4.1%
Rhinotermitidae 4.1%
Hydrophilidae 2.7%
Curculionidae 1.4%
Passalidae 1.4%
Hodotermitidae 1.4%
Cixiidae 1.4%
Termopsidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864755708 Massilia timonae S00006 Isolate Elmidae
2 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
3 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
4 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
5 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
13 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
14 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
15 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
16 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
17 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
24 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
25 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
26 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
27 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
28 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
29 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
32 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
33 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
36 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
39 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
40 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
41 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
42 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
43 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
44 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
45 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
46 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
47 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
48 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
49 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
50 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
51 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
52 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
53 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
54 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
55 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
56 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
57 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
58 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
59 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
60 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
61 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
62 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
63 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
64 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
65 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
66 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
67 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
68 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
69 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
70 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
71 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
72 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
73 2617270844 Dyella sp. HyOG Isolate Cixiidae
74 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
75 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
76 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
77 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
78 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466734_007769 3300042623 Bacteria 8423
2 Ga0466734_095938 3300042623 Bacteria 4916
3 Ga0466704_244902 3300042643 Bacteria 52327
4 Ga0466716_167190 3300042605 Bacteria 2608
5 Ga0466719_034517 3300042606 Bacteria 2018
6 Ga0466728_140742 3300042620 Bacteria 2481
7 Ga0123356_10041422 3300010049 Bacteria 4291
8 Ga0123356_10521587 3300010049 Unclassified 1346
9 Ga0160443_100003 3300012848 Bacteria 802970
10 Ga0160434_101384 3300012850 Unclassified 4553
11 Ga0466692_071110 3300042591 Bacteria 106079
12 Ga0466696_347002 3300042596 Bacteria 2356
13 CVPL005L_10019516 3300002938 Bacteria 3595
14 Ga0102733_101174 3300006995 Bacteria 1600
15 Ga0103261_1001495 3300007083 Bacteria 3733
16 Ga0123357_10000248 3300009784 Bacteria 51506
17 Ga0466725_258002 3300042654 Bacteria 1221
18 Ga0466716_027275 3300042605 Bacteria 3676
19 Ga0466719_011199 3300042606 Bacteria 5103
20 Ga0466711_181637 3300042615 Bacteria 22291
21 Ga0466711_323713 3300042615 Bacteria 3184
22 Ga0466723_327720 3300042618 Bacteria 2689
23 Ga0466726_421841 3300042619 Bacteria 1295
24 Ga0123355_10150520 3300009826 Bacteria 3536
25 Ga0160464_100007 3300012805 Bacteria 362625
26 Ga0160448_100269 3300012854 Bacteria 20387
27 Ga0466692_040365 3300042591 Bacteria 62446
28 Ga0466693_267907 3300042592 Bacteria 1488
29 IMNBGM34_c000051 3300000036 Bacteria 32685
30 Ga0103266_1001097 3300007067 Bacteria 6032
31 Ga0102739_1001965 3300007095 Bacteria 3265
32 Ga0102739_1002264 3300007095 Bacteria 3002
33 Ga0103268_1000533 3300007192 Bacteria 11358
34 Ga0466734_087084 3300042623 Bacteria 7581
35 Ga0466704_356148 3300042643 Bacteria 3475
36 Ga0466708_383670 3300042652 Bacteria 15465
37 Ga0466719_230524 3300042606 Bacteria 6931
38 Ga0466722_095194 3300042609 Bacteria 5497
39 Ga0466722_239428 3300042609 Bacteria 6395
40 Ga0466726_014918 3300042619 Bacteria 10030
41 Ga0160444_100359 3300012841 Unclassified 25920
42 Ga0160447_101032 3300012849 Bacteria 11451
43 Ga0466657_295952 3300042582 Bacteria 1562
44 Ga0466696_036315 3300042596 Bacteria 3248
45 Ga0102737_1013918 3300007142 Bacteria 1298
46 Ga0103267_1022387 3300007190 Unclassified 2086
47 Ga0123357_10000005 3300009784 Bacteria 295874
48 Ga0466730_100685 3300042625 Unclassified 16698
49 Ga0466709_159721 3300042648 Bacteria 3831
50 Ga0466725_394147 3300042654 Bacteria 8471
51 Ga0466701_043591 3300042598 Bacteria 136062
52 Ga0466719_142743 3300042606 Bacteria 4041
53 Ga0466722_253205 3300042609 Bacteria 2894
54 Ga0466723_354157 3300042618 Bacteria 25046
55 Ga0123355_10025730 3300009826 Bacteria 9477
56 Ga0160430_104108 3300012852 Bacteria 3752
57 Ga0160436_1000360 3300012861 Bacteria 19354
58 Ga0160436_1003510 3300012861 Bacteria 3837
59 Ga0102736_1000989 3300007052 Bacteria 5222
60 Ga0466734_068372 3300042623 Bacteria 2806
61 Ga0466724_57906 3300042649 Bacteria 581904
62 Ga0466708_111323 3300042652 Bacteria 1501
63 Ga0466725_221145 3300042654 Bacteria 45968
64 Ga0466701_027129 3300042598 Bacteria 3651
65 Ga0466719_246513 3300042606 Bacteria 3822
66 Ga0466722_261023 3300042609 Bacteria 4920
67 Ga0466710_182343 3300042613 Bacteria 6286
68 Ga0466710_249192 3300042613 Bacteria 63183
69 Ga0466729_077694 3300042621 Bacteria 6277
70 Ga0160468_100596 3300012819 Unclassified 13481
71 Ga0160445_101514 3300012847 Unclassified 6382
72 Ga0466691_121855 3300042593 Bacteria 20312
73 Ga0466696_238677 3300042596 Bacteria 1752
74 Ga0102736_1002966 3300007052 Unclassified 2567
75 Ga0102735_1000865 3300007080 Bacteria 12474
76 Ga0103264_1011846 3300007188 Bacteria 4489
77 Ga0466729_232375 3300042621 Bacteria 60363
78 Ga0466730_044445 3300042625 Bacteria 1804
79 Ga0466704_250002 3300042643 Bacteria 8050
80 Ga0466704_555754 3300042643 Bacteria 3165
81 Ga0466708_192936 3300042652 Bacteria 3674
82 Ga0466708_206327 3300042652 Bacteria 22043
83 Ga0466725_023073 3300042654 Bacteria 10221
84 Ga0466725_230125 3300042654 Bacteria 55475
85 Ga0466719_340622 3300042606 Bacteria 10934
86 Ga0466715_184324 3300042616 Unclassified 2020
87 Ga0123356_10006584 3300010049 Unclassified 11706
88 Ga0123356_10173136 3300010049 Bacteria 2172
89 Ga0123356_10611445 3300010049 Bacteria 1255
90 Ga0160440_100016 3300012815 Bacteria 324758
91 Ga0160469_100057 3300012824 Bacteria 191828
92 Ga0160467_100344 3300012829 Bacteria 49388
93 Ga0160444_100096 3300012841 Bacteria 110805
94 Ga0160443_101747 3300012848 Unclassified 6259
95 Ga0160435_1002466 3300012857 Unclassified 4493
96 Ga0102740_1001491 3300007140 Bacteria 5926
97 Ga0466705_059463 3300042612 Bacteria 40059
98 Ga0466734_106793 3300042623 Bacteria 14924
99 Ga0466725_168530 3300042654 Bacteria 6180
100 Ga0466707_028851 3300042601 Unclassified 2468
101 Ga0466715_102226 3300042616 Bacteria 2142
102 Ga0123355_10235264 3300009826 Unclassified 2607
103 Ga0123355_10339137 3300009826 Bacteria 2004
104 Ga0123353_10006326 3300010167 Bacteria 15750
105 Ga0466691_013121 3300042593 Bacteria 1584
106 Ga0466696_267532 3300042596 Bacteria 4508
107 Ga0466704_409571 3300042643 Bacteria 1994
108 Ga0466708_042504 3300042652 Bacteria 7526
109 Ga0466708_264700 3300042652 Bacteria 16707
110 Ga0466708_370311 3300042652 Bacteria 15205
111 Ga0466706_060912 3300042599 Bacteria 2326
112 Ga0466707_187338 3300042601 Bacteria 3982
113 Ga0466719_158372 3300042606 Bacteria 3036
114 Ga0466710_356480 3300042613 Bacteria 1603
115 Ga0466715_474740 3300042616 Bacteria 2085
116 Ga0466729_023340 3300042621 Bacteria 15752
117 Ga0160446_101486 3300012835 Unclassified 5002
118 Ga0160433_100437 3300012846 Bacteria 21570
119 Ga0160445_100028 3300012847 Bacteria 187936
120 Ga0466657_117791 3300042582 Bacteria 208686
121 Ga0466691_131620 3300042593 Bacteria 6840
122 Ga0466695_224256 3300042595 Bacteria 3935
123 DPOL_contig10389 2035918003 Unclassified 1478
124 CVPL010W_10011199 3300002931 Bacteria 7528
125 Ga0103260_1000489 3300007139 Unclassified 7569
126 Ga0103264_1004120 3300007188 Bacteria 7171

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042592 Ga0466693_267907 Ga0466693_267907_434_1327 297
2 3300042601 Ga0466707_028851 Ga0466707_028851_1541_2434 297
3 3300042609 Ga0466722_239428 Ga0466722_239428_177_1070 297
4 3300042593 Ga0466691_131620 Ga0466691_131620_4788_5684 298
5 iso_pr_bacteria 2864826666 2864829712 298
6 iso_pr_bacteria 2873571580 2873574661 298
7 3300042649 Ga0466724_57906 Ga0466724_57906_59640_60539 299
8 3300042598 Ga0466701_027129 Ga0466701_027129_304_1206 300
9 3300010049 Ga0123356_10611445 Ga0123356_106114452 301
10 3300042652 Ga0466708_042504 Ga0466708_042504_5761_6702 301
11 3300009826 Ga0123355_10339137 Ga0123355_103391372 303
12 3300042599 Ga0466706_060912 Ga0466706_060912_966_1904 306
13 3300042643 Ga0466704_356148 Ga0466704_356148_2377_3297 306
14 3300042606 Ga0466719_142743 Ga0466719_142743_2819_3745 308
15 3300042623 Ga0466734_068372 Ga0466734_068372_1542_2468 308
16 3300042591 Ga0466692_071110 Ga0466692_071110_50890_51819 309
17 3300042595 Ga0466695_224256 Ga0466695_224256_1078_2010 310
18 3300042596 Ga0466696_267532 Ga0466696_267532_2387_3319 310
19 3300042613 Ga0466710_182343 Ga0466710_182343_395_1327 310
20 3300042621 Ga0466729_077694 Ga0466729_077694_4407_5339 310
21 3300042623 Ga0466734_095938 Ga0466734_095938_1749_2681 310
22 3300042623 Ga0466734_106793 Ga0466734_106793_10864_11796 310
23 iso_pr_bacteria 2548876789 2549849515 310
24 iso_pr_bacteria 2648501628 2650560286 310
25 iso_pr_bacteria 2820123897 2820124446 310
26 3300002931 CVPL010W_10011199 CVPL010W_100111995 311
27 3300002938 CVPL005L_10019516 CVPL005L_100195163 311
28 3300006995 Ga0102733_101174 Ga0102733_1011742 311
29 3300007052 Ga0102736_1000989 Ga0102736_10009892 311
30 3300007052 Ga0102736_1002966 Ga0102736_10029662 311
31 3300007067 Ga0103266_1001097 Ga0103266_10010975 311
32 3300007080 Ga0102735_1000865 Ga0102735_100086513 311
33 3300007095 Ga0102739_1001965 Ga0102739_10019653 311
34 3300007095 Ga0102739_1002264 Ga0102739_10022642 311
35 3300007139 Ga0103260_1000489 Ga0103260_10004894 311
36 3300007140 Ga0102740_1001491 Ga0102740_10014912 311
37 3300007142 Ga0102737_1013918 Ga0102737_10139182 311
38 3300007188 Ga0103264_1011846 Ga0103264_10118463 311
39 3300007190 Ga0103267_1022387 Ga0103267_10223872 311
40 3300007192 Ga0103268_1000533 Ga0103268_10005333 311
41 3300009784 Ga0123357_10000005 Ga0123357_10000005227 311
42 3300012815 Ga0160440_100016 Ga0160440_100016181 311
43 3300012835 Ga0160446_101486 Ga0160446_1014866 311
44 3300012841 Ga0160444_100096 Ga0160444_10009622 311
45 3300012847 Ga0160445_100028 Ga0160445_100028157 311
46 3300012849 Ga0160447_101032 Ga0160447_1010324 311
47 3300012850 Ga0160434_101384 Ga0160434_1013846 311
48 3300012857 Ga0160435_1002466 Ga0160435_10024662 311
49 3300012861 Ga0160436_1000360 Ga0160436_100036015 311
50 3300012861 Ga0160436_1003510 Ga0160436_10035104 311
51 3300042582 Ga0466657_117791 Ga0466657_117791_168641_169576 311
52 3300042593 Ga0466691_013121 Ga0466691_013121_313_1248 311
53 3300042596 Ga0466696_238677 Ga0466696_238677_215_1150 311
54 3300042596 Ga0466696_347002 Ga0466696_347002_1215_2150 311
55 3300042601 Ga0466707_187338 Ga0466707_187338_721_1656 311
56 3300042605 Ga0466716_027275 Ga0466716_027275_1281_2216 311
57 3300042605 Ga0466716_167190 Ga0466716_167190_602_1537 311
58 3300042606 Ga0466719_034517 Ga0466719_034517_32_967 311
59 3300042606 Ga0466719_158372 Ga0466719_158372_1033_1968 311
60 3300042609 Ga0466722_253205 Ga0466722_253205_1662_2597 311
61 3300042609 Ga0466722_261023 Ga0466722_261023_200_1135 311
62 3300042613 Ga0466710_249192 Ga0466710_249192_3691_4626 311
63 3300042613 Ga0466710_356480 Ga0466710_356480_524_1459 311
64 3300042615 Ga0466711_323713 Ga0466711_323713_777_1712 311
65 3300042616 Ga0466715_102226 Ga0466715_102226_1183_2118 311
66 3300042616 Ga0466715_184324 Ga0466715_184324_978_1913 311
67 3300042616 Ga0466715_474740 Ga0466715_474740_841_1776 311
68 3300042619 Ga0466726_014918 Ga0466726_014918_1532_2467 311
69 3300042621 Ga0466729_023340 Ga0466729_023340_12831_13766 311
70 3300042623 Ga0466734_087084 Ga0466734_087084_5573_6508 311
71 3300042625 Ga0466730_044445 Ga0466730_044445_83_1018 311
72 3300042643 Ga0466704_250002 Ga0466704_250002_1366_2301 311
73 3300042643 Ga0466704_409571 Ga0466704_409571_831_1766 311
74 3300042643 Ga0466704_555754 Ga0466704_555754_2096_3031 311
75 3300042648 Ga0466709_159721 Ga0466709_159721_864_1799 311
76 3300042652 Ga0466708_111323 Ga0466708_111323_529_1464 311
77 3300042652 Ga0466708_192936 Ga0466708_192936_1968_2903 311
78 3300042654 Ga0466725_230125 Ga0466725_230125_32788_33723 311
79 3300042654 Ga0466725_258002 Ga0466725_258002_116_1051 311
80 3300042654 Ga0466725_394147 Ga0466725_394147_5509_6444 311
81 iso_pr_bacteria 2617270844 2617735159 311
82 iso_pr_bacteria 2820084079 2820085558 311
83 iso_pr_bacteria 2820086750 2820089131 311
84 iso_pr_bacteria 2820103659 2820104502 311
85 iso_pr_bacteria 2820132692 2820133634 311
86 iso_pr_bacteria 2820152154 2820153272 311
87 iso_pr_bacteria 2873562573 2873562587 311
88 2035918003 DPOL_contig10389 DPOLB_1342250 312
89 3300007083 Ga0103261_1001495 Ga0103261_10014952 312
90 3300009784 Ga0123357_10000248 Ga0123357_1000024819 312
91 3300010049 Ga0123356_10041422 Ga0123356_100414223 312
92 3300010049 Ga0123356_10521587 Ga0123356_105215871 312
93 3300010167 Ga0123353_10006326 Ga0123353_1000632613 312
94 3300012824 Ga0160469_100057 Ga0160469_10005785 312
95 3300012854 Ga0160448_100269 Ga0160448_1002695 312
96 3300042598 Ga0466701_043591 Ga0466701_043591_60662_61600 312
97 3300042623 Ga0466734_007769 Ga0466734_007769_2167_3105 312
98 3300042625 Ga0466730_100685 Ga0466730_100685_8149_9087 312
99 3300042654 Ga0466725_221145 Ga0466725_221145_44712_45650 312
100 iso_pr_bacteria 2864761044 2864762938 312
101 3300012805 Ga0160464_100007 Ga0160464_10000756 313
102 3300012819 Ga0160468_100596 Ga0160468_1005965 313
103 3300012829 Ga0160467_100344 Ga0160467_1003448 313
104 3300012841 Ga0160444_100359 Ga0160444_1003595 313
105 3300012847 Ga0160445_101514 Ga0160445_1015142 313
106 3300012848 Ga0160443_101747 Ga0160443_1017476 313
107 3300012852 Ga0160430_104108 Ga0160430_1041083 313
108 3300042606 Ga0466719_230524 Ga0466719_230524_77_1018 313
109 3300042615 Ga0466711_181637 Ga0466711_181637_11498_12439 313
110 3300042618 Ga0466723_327720 Ga0466723_327720_226_1167 313
111 3300042621 Ga0466729_232375 Ga0466729_232375_47339_48280 313
112 3300042652 Ga0466708_206327 Ga0466708_206327_393_1334 313
113 3300042652 Ga0466708_370311 Ga0466708_370311_1020_1961 313
114 3300042654 Ga0466725_023073 Ga0466725_023073_4624_5580 313
115 iso_pr_bacteria 2864755708 2864757257 313
116 3300042606 Ga0466719_011199 Ga0466719_011199_1468_2412 314
117 3300042606 Ga0466719_246513 Ga0466719_246513_1676_2620 314
118 3300042652 Ga0466708_264700 Ga0466708_264700_10215_11159 314
119 3300042652 Ga0466708_383670 Ga0466708_383670_11768_12712 314
120 3300042654 Ga0466725_168530 Ga0466725_168530_2469_3413 314
121 3300009826 Ga0123355_10235264 Ga0123355_102352642 315
122 3300010049 Ga0123356_10173136 Ga0123356_101731362 315
123 3300042593 Ga0466691_121855 Ga0466691_121855_4291_5238 315
124 3300042643 Ga0466704_244902 Ga0466704_244902_36233_37180 315
125 iso_pr_bacteria 2891720358 2891724373 315
126 3300009826 Ga0123355_10150520 Ga0123355_101505204 316
127 3300012846 Ga0160433_100437 Ga0160433_10043710 316
128 3300007188 Ga0103264_1004120 Ga0103264_10041203 317
129 3300042606 Ga0466719_340622 Ga0466719_340622_6848_7801 317
130 3300012848 Ga0160443_100003 Ga0160443_100003535 318
131 3300000036 IMNBGM34_c000051 IMNBGM34_00005124 319
132 3300042619 Ga0466726_421841 Ga0466726_421841_313_1275 320
133 3300042609 Ga0466722_095194 Ga0466722_095194_3290_4258 322
134 3300042612 Ga0466705_059463 Ga0466705_059463_11934_12902 322
135 3300009826 Ga0123355_10025730 Ga0123355_100257306 324
136 3300010049 Ga0123356_10006584 Ga0123356_100065849 324
137 3300042582 Ga0466657_295952 Ga0466657_295952_547_1521 324
138 3300042591 Ga0466692_040365 Ga0466692_040365_42420_43394 324
139 3300042620 Ga0466728_140742 Ga0466728_140742_658_1632 324
140 3300042596 Ga0466696_036315 Ga0466696_036315_198_1181 327
141 3300042618 Ga0466723_354157 Ga0466723_354157_7346_8485 379

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00294 PfkB pfkB family carbohydrate kinase 27 306 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.