Protein Family IF04619
Metagenome
Isolate
118
Members
40
Samples
117
Scaffolds
285.69
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_031129|Ga0466692_031129_4794_6014
- Length
- 317 aa
- Sequence
- MTGYGYQEQQDQEAFLSVEIKGYNSRFLEMTVNLPPQISGLDHEIRRYMADRCRRGKIEVNLRLREYDTAFSVSLNRGAVNAYLAAIAGLRKTILETDFSFLKKNSLKKDFLKEEKDYPPKTPQTALFEFALQNLGLILGLEGILEIEKNGNKGAYWGRIEPVLRSAADQFEAYRVREGKHTEEAIFSHLSVIESAAEVIAENIPVLEGTIKENLKTRFLELQKDLDENRVLAETAVLLMKYSIAEEVSRISAHLKEFRAEADRNPSPGKKLDFLCQELNREINTIGSKTPVLEVSRAVVAMKDALENIREQLRNIE
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.8%
Termitidae
31.6%
Termopsidae
10.5%
Rhinotermitidae
10.5%
Unclassified
10.5%
Taxonomy
Archaea
1
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 31 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 32 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_095351 | 3300042659 | Bacteria | 1359 |
| 2 | Ga0466711_269667 | 3300042615 | Bacteria | 4220 |
| 3 | Ga0466715_486104 | 3300042616 | Bacteria | 13693 |
| 4 | Ga0466723_051308 | 3300042618 | Bacteria | 6633 |
| 5 | Ga0466729_024943 | 3300042621 | Bacteria | 5538 |
| 6 | Ga0466703_180800 | 3300042636 | Bacteria | 3856 |
| 7 | Ga0466708_024325 | 3300042652 | Bacteria | 2718 |
| 8 | Ga0466727_186493 | 3300042655 | Bacteria | 1650 |
| 9 | AustNasuHG_c1004208 | 3300000089 | Bacteria | 5169 |
| 10 | Ga0466716_068978 | 3300042605 | Bacteria | 4250 |
| 11 | Ga0466716_129001 | 3300042605 | Bacteria | 5719 |
| 12 | Ga0466690_378921 | 3300042590 | Bacteria | 5839 |
| 13 | Ga0466692_112923 | 3300042591 | Bacteria | 1006 |
| 14 | Ga0466694_317424 | 3300042594 | Bacteria | 9831 |
| 15 | Ga0466696_189895 | 3300042596 | Bacteria | 1990 |
| 16 | Ga0466696_276288 | 3300042596 | Bacteria | 4805 |
| 17 | Ga0466732_061908 | 3300042656 | Bacteria | 5011 |
| 18 | Ga0466728_155284 | 3300042620 | Bacteria | 6951 |
| 19 | Ga0466709_035811 | 3300042648 | Bacteria | 26941 |
| 20 | Ga0466708_306675 | 3300042652 | Bacteria | 2642 |
| 21 | Ga0466727_318489 | 3300042655 | Bacteria | 4179 |
| 22 | JGI24695J34938_10072733 | 3300002450 | Bacteria | 1433 |
| 23 | Ga0072941_1073391 | 3300005201 | Bacteria | 3019 |
| 24 | Ga0466707_370680 | 3300042601 | Bacteria | 1038 |
| 25 | Ga0466716_092040 | 3300042605 | Bacteria | 8468 |
| 26 | Ga0466719_016801 | 3300042606 | Bacteria | 34227 |
| 27 | Ga0466705_221228 | 3300042612 | Bacteria | 6333 |
| 28 | Ga0466733_150218 | 3300042659 | Bacteria | 5129 |
| 29 | Ga0466711_083525 | 3300042615 | Bacteria | 3495 |
| 30 | Ga0466711_266647 | 3300042615 | Bacteria | 38140 |
| 31 | Ga0466715_224207 | 3300042616 | Bacteria | 5492 |
| 32 | Ga0466703_407623 | 3300042636 | Bacteria | 1737 |
| 33 | Ga0466709_061453 | 3300042648 | Bacteria | 3334 |
| 34 | Ga0466709_258825 | 3300042648 | Bacteria | 56335 |
| 35 | Ga0466727_041769 | 3300042655 | Unclassified | 1315 |
| 36 | Ga0466727_312943 | 3300042655 | Bacteria | 1304 |
| 37 | Ga0072941_1083423 | 3300005201 | Bacteria | 3550 |
| 38 | Ga0466713_103540 | 3300042602 | Unclassified | 1161 |
| 39 | Ga0466719_358399 | 3300042606 | Bacteria | 5889 |
| 40 | Ga0123355_10465199 | 3300009826 | Bacteria | 1584 |
| 41 | Ga0466712_188830 | 3300042614 | Bacteria | 2015 |
| 42 | Ga0466711_114987 | 3300042615 | Bacteria | 4592 |
| 43 | Ga0466715_110604 | 3300042616 | Bacteria | 21223 |
| 44 | Ga0466715_382797 | 3300042616 | Bacteria | 20304 |
| 45 | Ga0466723_115991 | 3300042618 | Bacteria | 4245 |
| 46 | Ga0466735_044462 | 3300042624 | Bacteria | 2082 |
| 47 | Ga0466703_082590 | 3300042636 | Bacteria | 51436 |
| 48 | Ga0466704_315953 | 3300042643 | Bacteria | 2109 |
| 49 | Ga0466708_074332 | 3300042652 | Bacteria | 2043 |
| 50 | Ga0466708_134179 | 3300042652 | Bacteria | 10863 |
| 51 | Ga0466708_363843 | 3300042652 | Bacteria | 2606 |
| 52 | Ga0466716_087174 | 3300042605 | Unclassified | 8804 |
| 53 | Ga0466719_285091 | 3300042606 | Bacteria | 30775 |
| 54 | Ga0466692_095794 | 3300042591 | Bacteria | 24513 |
| 55 | Ga0466705_071788 | 3300042612 | Bacteria | 9748 |
| 56 | Ga0466733_210602 | 3300042659 | Bacteria | 42790 |
| 57 | Ga0466728_135788 | 3300042620 | Bacteria | 13721 |
| 58 | Ga0466704_165413 | 3300042643 | Bacteria | 4471 |
| 59 | Ga0466709_001356 | 3300042648 | Bacteria | 34748 |
| 60 | Ga0068305_10001613 | 3300005083 | Bacteria | 3405 |
| 61 | Ga0466707_137507 | 3300042601 | Bacteria | 4239 |
| 62 | Ga0466716_197727 | 3300042605 | Bacteria | 5153 |
| 63 | Ga0466719_149587 | 3300042606 | Bacteria | 3320 |
| 64 | Ga0264413_117102 | 3300024493 | Bacteria | 5446 |
| 65 | Ga0264413_117103 | 3300024493 | Bacteria | 3749 |
| 66 | Ga0415639_244356 | 3300038395 | Bacteria | 1975 |
| 67 | Ga0466692_031129 | 3300042591 | Archaea | 21859 |
| 68 | Ga0466691_031634 | 3300042593 | Bacteria | 9994 |
| 69 | Ga0466705_257349 | 3300042612 | Bacteria | 2949 |
| 70 | Ga0466712_008021 | 3300042614 | Bacteria | 58516 |
| 71 | Ga0466723_051295 | 3300042618 | Bacteria | 1216 |
| 72 | Ga0466723_126127 | 3300042618 | Bacteria | 33633 |
| 73 | Ga0466728_217884 | 3300042620 | Bacteria | 15175 |
| 74 | Ga0466703_017168 | 3300042636 | Bacteria | 2223 |
| 75 | JGI24698J34947_10032486 | 3300002449 | Bacteria | 2740 |
| 76 | Ga0466716_001149 | 3300042605 | Unclassified | 1163 |
| 77 | Ga0466716_244760 | 3300042605 | Bacteria | 2411 |
| 78 | Ga0466722_031703 | 3300042609 | Bacteria | 3321 |
| 79 | Ga0456237_0002150 | 3300041968 | Bacteria | 3183 |
| 80 | Ga0466690_278752 | 3300042590 | Bacteria | 1517 |
| 81 | Ga0466691_076513 | 3300042593 | Bacteria | 10152 |
| 82 | Ga0466696_282190 | 3300042596 | Bacteria | 1399 |
| 83 | Ga0466705_231026 | 3300042612 | Bacteria | 15378 |
| 84 | Ga0466733_099830 | 3300042659 | Bacteria | 29117 |
| 85 | Ga0466715_245983 | 3300042616 | Bacteria | 27497 |
| 86 | Ga0466723_051828 | 3300042618 | Bacteria | 9435 |
| 87 | Ga0466723_304168 | 3300042618 | Bacteria | 16728 |
| 88 | Ga0466723_320598 | 3300042618 | Bacteria | 4524 |
| 89 | Ga0466726_009914 | 3300042619 | Bacteria | 1295 |
| 90 | Ga0466726_076671 | 3300042619 | Bacteria | 7279 |
| 91 | Ga0466731_028947 | 3300042622 | Bacteria | 1525 |
| 92 | Ga0466704_594868 | 3300042643 | Bacteria | 2055 |
| 93 | Ga0074263_109186 | 3300005485 | Bacteria | 1672 |
| 94 | Ga0466690_155561 | 3300042590 | Bacteria | 1466 |
| 95 | Ga0466691_027625 | 3300042593 | Bacteria | 7709 |
| 96 | Ga0466691_062274 | 3300042593 | Bacteria | 3709 |
| 97 | Ga0466696_050570 | 3300042596 | Bacteria | 3632 |
| 98 | Ga0466696_244846 | 3300042596 | Bacteria | 12317 |
| 99 | Ga0466696_248413 | 3300042596 | Bacteria | 5205 |
| 100 | Ga0466705_224184 | 3300042612 | Bacteria | 17581 |
| 101 | Ga0466733_100356 | 3300042659 | Bacteria | 20994 |
| 102 | Ga0466715_192875 | 3300042616 | Bacteria | 1047 |
| 103 | Ga0466723_236585 | 3300042618 | Bacteria | 5319 |
| 104 | Ga0466723_294471 | 3300042618 | Bacteria | 31115 |
| 105 | Ga0466726_244911 | 3300042619 | Bacteria | 2462 |
| 106 | Ga0466729_038189 | 3300042621 | Bacteria | 1357 |
| 107 | Ga0466731_029523 | 3300042622 | Bacteria | 6369 |
| 108 | Ga0466703_243290 | 3300042636 | Bacteria | 3045 |
| 109 | Ga0466704_003935 | 3300042643 | Bacteria | 6000 |
| 110 | Ga0466704_620428 | 3300042643 | Bacteria | 1026 |
| 111 | Ga0466709_187453 | 3300042648 | Bacteria | 7099 |
| 112 | Ga0466727_274045 | 3300042655 | Bacteria | 2276 |
| 113 | Ga0068302_10442770 | 3300005071 | Bacteria | 939 |
| 114 | Ga0466716_372564 | 3300042605 | Bacteria | 3827 |
| 115 | Ga0466719_017944 | 3300042606 | Bacteria | 23045 |
| 116 | Ga0466720_227245 | 3300042607 | Bacteria | 11614 |
| 117 | Ga0466694_029092 | 3300042594 | Bacteria | 1464 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042602 | Ga0466713_103540 | Ga0466713_103540_39_725 | 228 |
| 2 | 3300042622 | Ga0466731_028947 | Ga0466731_028947_627_1484 | 258 |
| 3 | 3300042594 | Ga0466694_029092 | Ga0466694_029092_448_1305 | 259 |
| 4 | 3300042643 | Ga0466704_594868 | Ga0466704_594868_369_1235 | 265 |
| 5 | 3300042659 | Ga0466733_100356 | Ga0466733_100356_4280_5137 | 269 |
| 6 | 3300042606 | Ga0466719_358399 | Ga0466719_358399_2781_3647 | 270 |
| 7 | 3300042616 | Ga0466715_486104 | Ga0466715_486104_1194_2060 | 270 |
| 8 | 3300042618 | Ga0466723_236585 | Ga0466723_236585_3959_4825 | 270 |
| 9 | 3300042636 | Ga0466703_407623 | Ga0466703_407623_190_1047 | 270 |
| 10 | 3300038395 | Ga0415639_244356 | Ga0415639_244356_375_1241 | 272 |
| 11 | 3300042636 | Ga0466703_243290 | Ga0466703_243290_2150_3016 | 272 |
| 12 | 3300042616 | Ga0466715_192875 | Ga0466715_192875_78_935 | 273 |
| 13 | 3300000089 | AustNasuHG_c1004208 | AustNasuHG_10042086 | 274 |
| 14 | 3300005083 | Ga0068305_10001613 | Ga0068305_100016132 | 274 |
| 15 | 3300042612 | Ga0466705_257349 | Ga0466705_257349_1311_2168 | 274 |
| 16 | 3300042659 | Ga0466733_210602 | Ga0466733_210602_6699_7556 | 275 |
| 17 | 3300005071 | Ga0068302_10442770 | Ga0068302_104427701 | 276 |
| 18 | 3300002450 | JGI24695J34938_10072733 | JGI24695J34938_100727332 | 277 |
| 19 | 3300042596 | Ga0466696_276288 | Ga0466696_276288_2216_3106 | 278 |
| 20 | 3300024493 | Ga0264413_117103 | Ga0264413_1171031 | 280 |
| 21 | 3300042614 | Ga0466712_008021 | Ga0466712_008021_22425_23279 | 284 |
| 22 | 3300042590 | Ga0466690_278752 | Ga0466690_278752_461_1318 | 285 |
| 23 | 3300042590 | Ga0466690_378921 | Ga0466690_378921_3513_4370 | 285 |
| 24 | 3300042596 | Ga0466696_244846 | Ga0466696_244846_10275_11132 | 285 |
| 25 | 3300042596 | Ga0466696_248413 | Ga0466696_248413_446_1303 | 285 |
| 26 | 3300042596 | Ga0466696_282190 | Ga0466696_282190_414_1271 | 285 |
| 27 | 3300042605 | Ga0466716_001149 | Ga0466716_001149_288_1145 | 285 |
| 28 | 3300042605 | Ga0466716_197727 | Ga0466716_197727_1313_2170 | 285 |
| 29 | 3300042605 | Ga0466716_372564 | Ga0466716_372564_1834_2691 | 285 |
| 30 | 3300042606 | Ga0466719_149587 | Ga0466719_149587_1776_2633 | 285 |
| 31 | 3300042607 | Ga0466720_227245 | Ga0466720_227245_8829_9686 | 285 |
| 32 | 3300042612 | Ga0466705_231026 | Ga0466705_231026_12764_13621 | 285 |
| 33 | 3300042615 | Ga0466711_269667 | Ga0466711_269667_2240_3097 | 285 |
| 34 | 3300042616 | Ga0466715_110604 | Ga0466715_110604_15482_16339 | 285 |
| 35 | 3300042616 | Ga0466715_224207 | Ga0466715_224207_1536_2393 | 285 |
| 36 | 3300042616 | Ga0466715_245983 | Ga0466715_245983_1851_2708 | 285 |
| 37 | 3300042616 | Ga0466715_382797 | Ga0466715_382797_5490_6347 | 285 |
| 38 | 3300042618 | Ga0466723_126127 | Ga0466723_126127_27829_28686 | 285 |
| 39 | 3300042620 | Ga0466728_155284 | Ga0466728_155284_5071_5928 | 285 |
| 40 | 3300042621 | Ga0466729_024943 | Ga0466729_024943_1135_1992 | 285 |
| 41 | 3300042622 | Ga0466731_029523 | Ga0466731_029523_663_1520 | 285 |
| 42 | 3300042636 | Ga0466703_082590 | Ga0466703_082590_27015_27872 | 285 |
| 43 | 3300042643 | Ga0466704_165413 | Ga0466704_165413_1930_2787 | 285 |
| 44 | 3300042648 | Ga0466709_035811 | Ga0466709_035811_13621_14478 | 285 |
| 45 | 3300042648 | Ga0466709_061453 | Ga0466709_061453_1455_2312 | 285 |
| 46 | 3300042648 | Ga0466709_258825 | Ga0466709_258825_31380_32237 | 285 |
| 47 | 3300042652 | Ga0466708_074332 | Ga0466708_074332_206_1063 | 285 |
| 48 | 3300042652 | Ga0466708_306675 | Ga0466708_306675_1006_1863 | 285 |
| 49 | 3300042655 | Ga0466727_186493 | Ga0466727_186493_762_1619 | 285 |
| 50 | 3300042655 | Ga0466727_312943 | Ga0466727_312943_113_970 | 285 |
| 51 | 3300042655 | Ga0466727_318489 | Ga0466727_318489_1668_2525 | 285 |
| 52 | 3300042615 | Ga0466711_114987 | Ga0466711_114987_1706_2569 | 287 |
| 53 | 3300024493 | Ga0264413_117102 | Ga0264413_1171024 | 288 |
| 54 | 3300042590 | Ga0466690_155561 | Ga0466690_155561_116_982 | 288 |
| 55 | 3300042591 | Ga0466692_112923 | Ga0466692_112923_46_912 | 288 |
| 56 | 3300042593 | Ga0466691_027625 | Ga0466691_027625_4208_5074 | 288 |
| 57 | 3300042593 | Ga0466691_031634 | Ga0466691_031634_1569_2435 | 288 |
| 58 | 3300042593 | Ga0466691_062274 | Ga0466691_062274_303_1169 | 288 |
| 59 | 3300042593 | Ga0466691_076513 | Ga0466691_076513_8831_9697 | 288 |
| 60 | 3300042594 | Ga0466694_317424 | Ga0466694_317424_5052_5918 | 288 |
| 61 | 3300042596 | Ga0466696_050570 | Ga0466696_050570_1571_2437 | 288 |
| 62 | 3300042596 | Ga0466696_189895 | Ga0466696_189895_1083_1949 | 288 |
| 63 | 3300042601 | Ga0466707_137507 | Ga0466707_137507_1514_2380 | 288 |
| 64 | 3300042601 | Ga0466707_370680 | Ga0466707_370680_131_997 | 288 |
| 65 | 3300042605 | Ga0466716_092040 | Ga0466716_092040_5928_6794 | 288 |
| 66 | 3300042605 | Ga0466716_129001 | Ga0466716_129001_4613_5479 | 288 |
| 67 | 3300042605 | Ga0466716_244760 | Ga0466716_244760_772_1638 | 288 |
| 68 | 3300042606 | Ga0466719_016801 | Ga0466719_016801_10405_11271 | 288 |
| 69 | 3300042612 | Ga0466705_071788 | Ga0466705_071788_6314_7180 | 288 |
| 70 | 3300042612 | Ga0466705_221228 | Ga0466705_221228_3878_4744 | 288 |
| 71 | 3300042612 | Ga0466705_224184 | Ga0466705_224184_4201_5067 | 288 |
| 72 | 3300042615 | Ga0466711_083525 | Ga0466711_083525_2074_2940 | 288 |
| 73 | 3300042615 | Ga0466711_266647 | Ga0466711_266647_27087_27953 | 288 |
| 74 | 3300042618 | Ga0466723_051295 | Ga0466723_051295_324_1190 | 288 |
| 75 | 3300042618 | Ga0466723_051308 | Ga0466723_051308_2038_2904 | 288 |
| 76 | 3300042618 | Ga0466723_115991 | Ga0466723_115991_1561_2427 | 288 |
| 77 | 3300042618 | Ga0466723_294471 | Ga0466723_294471_16846_17712 | 288 |
| 78 | 3300042618 | Ga0466723_304168 | Ga0466723_304168_1832_2698 | 288 |
| 79 | 3300042618 | Ga0466723_320598 | Ga0466723_320598_2787_3653 | 288 |
| 80 | 3300042619 | Ga0466726_009914 | Ga0466726_009914_13_879 | 288 |
| 81 | 3300042619 | Ga0466726_076671 | Ga0466726_076671_5597_6463 | 288 |
| 82 | 3300042620 | Ga0466728_135788 | Ga0466728_135788_6608_7474 | 288 |
| 83 | 3300042620 | Ga0466728_217884 | Ga0466728_217884_9800_10666 | 288 |
| 84 | 3300042621 | Ga0466729_038189 | Ga0466729_038189_123_989 | 288 |
| 85 | 3300042624 | Ga0466735_044462 | Ga0466735_044462_941_1807 | 288 |
| 86 | 3300042636 | Ga0466703_017168 | Ga0466703_017168_438_1304 | 288 |
| 87 | 3300042636 | Ga0466703_180800 | Ga0466703_180800_776_1642 | 288 |
| 88 | 3300042643 | Ga0466704_003935 | Ga0466704_003935_4644_5510 | 288 |
| 89 | 3300042643 | Ga0466704_315953 | Ga0466704_315953_851_1717 | 288 |
| 90 | 3300042643 | Ga0466704_620428 | Ga0466704_620428_60_926 | 288 |
| 91 | 3300042648 | Ga0466709_001356 | Ga0466709_001356_5671_6537 | 288 |
| 92 | 3300042648 | Ga0466709_187453 | Ga0466709_187453_6140_7006 | 288 |
| 93 | 3300042652 | Ga0466708_024325 | Ga0466708_024325_1538_2404 | 288 |
| 94 | 3300042652 | Ga0466708_134179 | Ga0466708_134179_9178_10044 | 288 |
| 95 | 3300042652 | Ga0466708_363843 | Ga0466708_363843_1192_2058 | 288 |
| 96 | 3300042655 | Ga0466727_041769 | Ga0466727_041769_432_1298 | 288 |
| 97 | 3300042655 | Ga0466727_274045 | Ga0466727_274045_960_1826 | 288 |
| 98 | 3300042656 | Ga0466732_061908 | Ga0466732_061908_3824_4690 | 288 |
| 99 | 3300042659 | Ga0466733_095351 | Ga0466733_095351_219_1085 | 288 |
| 100 | 3300042659 | Ga0466733_150218 | Ga0466733_150218_3706_4572 | 288 |
| 101 | iso_pr_bacteria | 650716102 | 650882364 | 288 |
| 102 | 3300002449 | JGI24698J34947_10032486 | JGI24698J34947_100324862 | 289 |
| 103 | 3300005201 | Ga0072941_1073391 | Ga0072941_10733912 | 289 |
| 104 | 3300005201 | Ga0072941_1083423 | Ga0072941_10834233 | 289 |
| 105 | 3300005485 | Ga0074263_109186 | Ga0074263_1091862 | 289 |
| 106 | 3300009826 | Ga0123355_10465199 | Ga0123355_104651992 | 289 |
| 107 | 3300042614 | Ga0466712_188830 | Ga0466712_188830_363_1292 | 293 |
| 108 | 3300042659 | Ga0466733_099830 | Ga0466733_099830_7070_7954 | 294 |
| 109 | 3300041968 | Ga0456237_0002150 | Ga0456237_0002150_2213_3100 | 295 |
| 110 | 3300042619 | Ga0466726_244911 | Ga0466726_244911_1399_2301 | 300 |
| 111 | 3300042591 | Ga0466692_095794 | Ga0466692_095794_7869_8774 | 301 |
| 112 | 3300042609 | Ga0466722_031703 | Ga0466722_031703_696_1604 | 302 |
| 113 | 3300042605 | Ga0466716_068978 | Ga0466716_068978_3074_3994 | 306 |
| 114 | 3300042606 | Ga0466719_285091 | Ga0466719_285091_26923_27852 | 309 |
| 115 | 3300042618 | Ga0466723_051828 | Ga0466723_051828_5805_6734 | 309 |
| 116 | 3300042605 | Ga0466716_087174 | Ga0466716_087174_1651_2586 | 311 |
| 117 | 3300042606 | Ga0466719_017944 | Ga0466719_017944_10797_11738 | 313 |
| 118 | 3300042591 | Ga0466692_031129 | Ga0466692_031129_4794_6014 | 317 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.65 | 0.7 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.