Protein Family IF04608

Metagenome Isolate
109 Members
45 Samples
103 Scaffolds
394.56 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_017852|Ga0466692_017852_1898_3202
Length
434 aa
Sequence
MGGGLARILLKDNGESIFTLPSIPVIIVYYYVRWRIAMQFRIDKKSGHKLSVLGFGCMRFPKNLGAIDMQKTESLIMDAIHGGVNYFDTAYMYPGSEEALGTILEKNKVREWVFVATKLPLVLVRGPEDFDRFFNKQLERLRTGYIDYYLMHMLTDMHLWEKLKDWGIEAWIKEKKQAEQIKQVGFSFHGSQPEFLKLLEAYPWEFCQIQYNYSGENFQAGIVGLKKAAERMSVMVMEPLLGGKLATGLPSEAVAIFKQANPALSPAAWALKWVWNHPEVTLLLSGMNHKRQLEENLDMAGKSASSMLTDEERETYRQVLNVFNAAYKIRCTGCNYCMPCPQHVNIPSCFAAYNTSFSIGFVSGMQQYLTSTGMTSEQTSSPRLCVKCGKCEDHCPQHLPIIKSLEAVRKRMEPFWFRGFIIIARRFLGRNKKK

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.8%
Kalotermitidae 31.8%
Unclassified 15.9%
Rhinotermitidae 9.1%
Termopsidae 6.8%
Passalidae 4.5%

🌳 Taxonomy

Archaea 0
Bacteria 103
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
2 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
3 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
20 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
21 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
30 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
31 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
32 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
35 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_402819 3300042612 Bacteria 4299
2 Ga0466710_010300 3300042613 Bacteria 5989
3 Ga0466712_163367 3300042614 Bacteria 5458
4 Ga0466715_357562 3300042616 Bacteria 1496
5 Ga0466715_440608 3300042616 Bacteria 4274
6 Ga0466704_051542 3300042643 Bacteria 13374
7 Ga0466704_392058 3300042643 Bacteria 1529
8 Ga0466700_249929 3300042600 Bacteria 3729
9 JGI24702J35022_10001713 3300002462 Bacteria 13602
10 Ga0123357_10000079 3300009784 Bacteria 77150
11 Ga0466696_183659 3300042596 Bacteria 3966
12 Ga0466703_406569 3300042636 Bacteria 2541
13 Ga0466704_094177 3300042643 Bacteria 1570
14 Ga0466708_358748 3300042652 Bacteria 2496
15 Ga0466701_075339 3300042598 Bacteria 7128
16 Ga0466707_408897 3300042601 Bacteria 5202
17 Ga0466722_029711 3300042609 Bacteria 6945
18 Ga0123357_10199394 3300009784 Bacteria 2282
19 Ga0123354_10026089 3300010882 Bacteria 9215
20 JGI24705J35276_12201344 3300002504 Unclassified 1616
21 Ga0068305_10047570 3300005083 Bacteria 4782
22 Ga0456237_0008902 3300041968 Bacteria 1505
23 Ga0466690_175525 3300042590 Bacteria 2006
24 Ga0466692_017852 3300042591 Bacteria 4079
25 Ga0466696_332909 3300042596 Bacteria 5998
26 Ga0466715_049697 3300042616 Bacteria 16425
27 Ga0466728_121071 3300042620 Bacteria 10991
28 Ga0466728_293289 3300042620 Bacteria 9191
29 Ga0466704_138404 3300042643 Bacteria 5042
30 Ga0466704_182260 3300042643 Bacteria 5563
31 Ga0466704_439686 3300042643 Bacteria 95559
32 Ga0466709_081184 3300042648 Bacteria 5984
33 Ga0466727_135810 3300042655 Bacteria 2829
34 Ga0466719_061422 3300042606 Bacteria 5464
35 Ga0466705_019333 3300042612 Unclassified 12990
36 Ga0456237_0000757 3300041968 Unclassified 5007
37 Ga0466694_234563 3300042594 Bacteria 1417
38 Ga0466712_037568 3300042614 Bacteria 7893
39 Ga0466711_129320 3300042615 Bacteria 2880
40 Ga0466726_002893 3300042619 Bacteria 6860
41 Ga0466728_484083 3300042620 Bacteria 5063
42 Ga0466735_062176 3300042624 Bacteria 9128
43 Ga0466703_209439 3300042636 Bacteria 17765
44 Ga0466704_026331 3300042643 Bacteria 4734
45 Ga0466707_070768 3300042601 Bacteria 71942
46 Ga0466716_542865 3300042605 Bacteria 13306
47 Ga0466719_143126 3300042606 Bacteria 13009
48 Ga0123354_10107532 3300010882 Bacteria 3714
49 2227166926 2225789004 Bacteria 8290
50 JGI24702J35022_10042901 3300002462 Bacteria 2408
51 Ga0466705_186885 3300042612 Bacteria 2486
52 Ga0456237_0001557 3300041968 Bacteria 3657
53 Ga0466715_118971 3300042616 Bacteria 1965
54 Ga0466729_211305 3300042621 Bacteria 1658
55 Ga0466735_061209 3300042624 Bacteria 23420
56 Ga0466709_191447 3300042648 Bacteria 8596
57 Ga0466708_117508 3300042652 Bacteria 5369
58 Ga0466708_207640 3300042652 Bacteria 13121
59 Ga0466722_149477 3300042609 Bacteria 21582
60 Ga0123356_10031952 3300010049 Bacteria 4926
61 JGI24698J34947_10006352 3300002449 Bacteria 6489
62 JGI24698J34947_10022727 3300002449 Unclassified 3359
63 JGI24702J35022_10005567 3300002462 Bacteria 7345
64 Ga0072941_1080826 3300005201 Bacteria 4780
65 Ga0466692_132530 3300042591 Bacteria 37722
66 Ga0466711_295976 3300042615 Bacteria 7904
67 Ga0466715_384931 3300042616 Bacteria 1564
68 Ga0466723_048605 3300042618 Bacteria 5133
69 Ga0466726_281879 3300042619 Bacteria 12324
70 Ga0466735_148931 3300042624 Bacteria 5347
71 Ga0466709_024761 3300042648 Bacteria 1215
72 Ga0466722_008744 3300042609 Bacteria 8339
73 Ga0466722_080962 3300042609 Bacteria 1940
74 Ga0466722_142869 3300042609 Bacteria 11235
75 2227100818 2225789004 Bacteria 1792
76 JGI24702J35022_10003830 3300002462 Unclassified 9025
77 Ga0068305_10038632 3300005083 Bacteria 2824
78 Ga0466705_364178 3300042612 Bacteria 11345
79 Ga0466691_058466 3300042593 Bacteria 2519
80 Ga0466691_127989 3300042593 Bacteria 2013
81 Ga0466696_212903 3300042596 Bacteria 2159
82 Ga0466696_317290 3300042596 Bacteria 9825
83 Ga0466729_208531 3300042621 Bacteria 1451
84 Ga0466729_293329 3300042621 Bacteria 1259
85 Ga0466708_100209 3300042652 Bacteria 2103
86 Ga0466716_301530 3300042605 Bacteria 2181
87 Ga0466719_471859 3300042606 Bacteria 4941
88 Ga0123353_10193358 3300010167 Bacteria 3209
89 Ga0123353_10223472 3300010167 Bacteria 2942
90 IMNBL1DRAFT_c0000015 3300000062 Bacteria 179817
91 Ga0466693_318255 3300042592 Bacteria 3682
92 Ga0466705_516939 3300042612 Bacteria 3612
93 Ga0466712_082997 3300042614 Unclassified 2378
94 Ga0466712_173060 3300042614 Bacteria 15755
95 Ga0466711_253005 3300042615 Bacteria 37030
96 Ga0466715_188740 3300042616 Bacteria 3690
97 Ga0466726_144949 3300042619 Bacteria 6272
98 Ga0466726_198321 3300042619 Bacteria 3802
99 Ga0466728_177705 3300042620 Bacteria 1703
100 Ga0466722_087702 3300042609 Bacteria 4922
101 JGI24702J35022_10010462 3300002462 Bacteria 5180
102 JGI24702J35022_10019626 3300002462 Bacteria 3676
103 JGI24702J35022_10036081 3300002462 Bacteria 2642

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_132530 Ga0466692_132530_36607_37698 354
2 3300042636 Ga0466703_406569 Ga0466703_406569_561_1646 361
3 3300041968 Ga0456237_0008902 Ga0456237_0008902_209_1333 365
4 3300042601 Ga0466707_070768 Ga0466707_070768_13229_14332 367
5 3300042596 Ga0466696_212903 Ga0466696_212903_403_1527 374
6 3300042606 Ga0466719_061422 Ga0466719_061422_2681_3805 374
7 3300042606 Ga0466719_143126 Ga0466719_143126_4258_5382 374
8 3300005201 Ga0072941_1080826 Ga0072941_10808267 375
9 3300042624 Ga0466735_061209 Ga0466735_061209_16355_17488 377
10 3300042652 Ga0466708_207640 Ga0466708_207640_4370_5503 377
11 3300042596 Ga0466696_332909 Ga0466696_332909_3690_4826 378
12 3300042636 Ga0466703_209439 Ga0466703_209439_13092_14228 378
13 3300042652 Ga0466708_117508 Ga0466708_117508_3239_4375 378
14 3300042620 Ga0466728_121071 Ga0466728_121071_8949_10088 379
15 3300042643 Ga0466704_094177 Ga0466704_094177_184_1323 379
16 3300042655 Ga0466727_135810 Ga0466727_135810_15_1154 379
17 3300042615 Ga0466711_253005 Ga0466711_253005_26828_28030 381
18 3300042621 Ga0466729_293329 Ga0466729_293329_101_1246 381
19 3300042648 Ga0466709_024761 Ga0466709_024761_21_1178 385
20 3300042609 Ga0466722_008744 Ga0466722_008744_4479_5639 386
21 iso_pr_bacteria 2820576413 2820579362 386
22 3300010049 Ga0123356_10031952 Ga0123356_100319522 387
23 iso_pr_bacteria 2820267566 2820268094 389
24 3300002462 JGI24702J35022_10001713 JGI24702J35022_1000171311 390
25 3300002462 JGI24702J35022_10005567 JGI24702J35022_100055673 390
26 3300002462 JGI24702J35022_10010462 JGI24702J35022_100104623 390
27 3300002462 JGI24702J35022_10042901 JGI24702J35022_100429013 390
28 3300042621 Ga0466729_208531 Ga0466729_208531_172_1386 390
29 3300042619 Ga0466726_002893 Ga0466726_002893_2366_3565 391
30 3300042605 Ga0466716_542865 Ga0466716_542865_8855_10036 393
31 3300002462 JGI24702J35022_10003830 JGI24702J35022_1000383013 394
32 3300002504 JGI24705J35276_12201344 JGI24705J35276_122013442 394
33 3300009784 Ga0123357_10199394 Ga0123357_101993942 394
34 3300042598 Ga0466701_075339 Ga0466701_075339_1113_2297 394
35 3300042600 Ga0466700_249929 Ga0466700_249929_631_1815 394
36 3300042619 Ga0466726_144949 Ga0466726_144949_1804_2988 394
37 iso_pr_bacteria 2781125688 2781424129 394
38 3300002462 JGI24702J35022_10019626 JGI24702J35022_100196263 395
39 3300002462 JGI24702J35022_10036081 JGI24702J35022_100360811 395
40 3300005083 Ga0068305_10038632 Ga0068305_100386323 395
41 3300005083 Ga0068305_10047570 Ga0068305_100475702 395
42 3300010167 Ga0123353_10193358 Ga0123353_101933582 395
43 3300010882 Ga0123354_10107532 Ga0123354_101075323 395
44 3300041968 Ga0456237_0000757 Ga0456237_0000757_1540_2727 395
45 3300042613 Ga0466710_010300 Ga0466710_010300_931_2118 395
46 3300042624 Ga0466735_062176 Ga0466735_062176_4070_5257 395
47 3300010882 Ga0123354_10026089 Ga0123354_100260895 396
48 3300042593 Ga0466691_058466 Ga0466691_058466_1300_2490 396
49 3300042594 Ga0466694_234563 Ga0466694_234563_12_1202 396
50 3300042609 Ga0466722_087702 Ga0466722_087702_2209_3399 396
51 3300042612 Ga0466705_516939 Ga0466705_516939_515_1705 396
52 3300042616 Ga0466715_440608 Ga0466715_440608_2653_3843 396
53 3300042619 Ga0466726_198321 Ga0466726_198321_2500_3690 396
54 3300042643 Ga0466704_138404 Ga0466704_138404_178_1368 396
55 iso_pr_bacteria 2781125666 2781343161 396
56 iso_pr_bacteria 2820813074 2820814149 396
57 3300009784 Ga0123357_10000079 Ga0123357_1000007917 397
58 3300041968 Ga0456237_0001557 Ga0456237_0001557_1826_3019 397
59 3300042643 Ga0466704_392058 Ga0466704_392058_89_1282 397
60 iso_pr_bacteria 2585428085 2587835160 397
61 3300042592 Ga0466693_318255 Ga0466693_318255_1510_2706 398
62 3300042601 Ga0466707_408897 Ga0466707_408897_1993_3189 398
63 3300042615 Ga0466711_129320 Ga0466711_129320_1434_2630 398
64 3300042615 Ga0466711_295976 Ga0466711_295976_411_1607 398
65 3300042648 Ga0466709_081184 Ga0466709_081184_297_1508 398
66 3300042652 Ga0466708_100209 Ga0466708_100209_375_1571 398
67 3300042652 Ga0466708_358748 Ga0466708_358748_789_1985 398
68 2225789004 2227100818 2227484275 399
69 3300010167 Ga0123353_10223472 Ga0123353_102234722 399
70 3300042614 Ga0466712_037568 Ga0466712_037568_3426_4625 399
71 3300042614 Ga0466712_082997 Ga0466712_082997_932_2131 399
72 3300042614 Ga0466712_163367 Ga0466712_163367_1292_2491 399
73 3300042616 Ga0466715_384931 Ga0466715_384931_211_1410 399
74 2225789004 2227166926 2227579609 400
75 3300002449 JGI24698J34947_10006352 JGI24698J34947_100063524 400
76 3300002449 JGI24698J34947_10022727 JGI24698J34947_100227275 400
77 3300042590 Ga0466690_175525 Ga0466690_175525_109_1311 400
78 3300042593 Ga0466691_127989 Ga0466691_127989_191_1393 400
79 3300042596 Ga0466696_183659 Ga0466696_183659_504_1706 400
80 3300042605 Ga0466716_301530 Ga0466716_301530_756_1958 400
81 3300042612 Ga0466705_364178 Ga0466705_364178_5928_7130 400
82 3300042616 Ga0466715_118971 Ga0466715_118971_188_1390 400
83 3300042620 Ga0466728_484083 Ga0466728_484083_2505_3707 400
84 3300042643 Ga0466704_026331 Ga0466704_026331_661_1863 400
85 3300042643 Ga0466704_439686 Ga0466704_439686_30317_31519 400
86 3300000062 IMNBL1DRAFT_c0000015 IMNBL1DRAFT_000001538 401
87 3300042609 Ga0466722_080962 Ga0466722_080962_119_1324 401
88 3300042612 Ga0466705_402819 Ga0466705_402819_1277_2482 401
89 3300042619 Ga0466726_281879 Ga0466726_281879_3496_4701 401
90 3300042596 Ga0466696_317290 Ga0466696_317290_5964_7172 402
91 3300042614 Ga0466712_173060 Ga0466712_173060_6997_8205 402
92 3300042616 Ga0466715_357562 Ga0466715_357562_88_1296 402
93 3300042620 Ga0466728_293289 Ga0466728_293289_7183_8391 402
94 3300042606 Ga0466719_471859 Ga0466719_471859_157_1368 403
95 3300042612 Ga0466705_019333 Ga0466705_019333_3917_5128 403
96 3300042612 Ga0466705_186885 Ga0466705_186885_817_2028 403
97 3300042648 Ga0466709_191447 Ga0466709_191447_3806_5017 403
98 3300042609 Ga0466722_149477 Ga0466722_149477_14332_15546 404
99 3300042624 Ga0466735_148931 Ga0466735_148931_694_1908 404
100 3300042616 Ga0466715_049697 Ga0466715_049697_2518_3735 405
101 3300042643 Ga0466704_051542 Ga0466704_051542_11515_12732 405
102 3300042609 Ga0466722_142869 Ga0466722_142869_9150_10370 406
103 3300042618 Ga0466723_048605 Ga0466723_048605_104_1324 406
104 3300042643 Ga0466704_182260 Ga0466704_182260_2868_4094 408
105 3300042609 Ga0466722_029711 Ga0466722_029711_4569_5798 409
106 3300042616 Ga0466715_188740 Ga0466715_188740_524_1756 410
107 3300042620 Ga0466728_177705 Ga0466728_177705_231_1523 425
108 3300042621 Ga0466729_211305 Ga0466729_211305_166_1512 428
109 3300042591 Ga0466692_017852 Ga0466692_017852_1898_3202 434

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13187 Fer4_9 4Fe-4S dicluster domain 330 398 0.95
PF00248 Aldo_ket_red Aldo/keto reductase family 53 300 0.87
PF13534 Fer4_17 4Fe-4S dicluster domain 330 399 0.8

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.