Protein Family IF04585

Metagenome Isolate
128 Members
55 Samples
119 Scaffolds
374.38 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_403235|Ga0466690_403235_125_1303
Length
392 aa
Sequence
MNSTVKIKVGITGQEGFIGSHLYNELGLLPEEFERIHFEKRYFTNNEQMENFVKRCDVIVHLAAVNRSIDNNELYNTNIELTHSLLGALNKTKTVSGIIFSSSTQEEFDNAYGKSKQECRRLFAQWAREHNAAFSGLIIPNVFGPFGKPNYNSFVATFCHHLVHSDEPHITANKEVKLVYVSSLCKHIISEIKNIGGIKNTQIKEEYIPHDWTKTVFEILNILKRYKENYFDQGIIPVLCDGNEINLFNTFRSFIDMKTYFPYRLQKHTDIRGSFIETVKTRMGGQFSFSTTMPGITRGDHFHTRKIERFAVMKGQARIQLRRIGTGNIFEFYLDGNNPSYVDMPVWYTHNITNIGDDKLYTQFWTNEWYDVSNPDTFFERVDNTEKQENIK

📊 Sample Types

Isolate 7.0%
Metagenome 93.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.3%
Kalotermitidae 27.5%
Rhinotermitidae 7.8%
Unclassified 5.9%
Hydrophilidae 3.9%
Cambaridae 3.9%
Termopsidae 3.9%
Daphniidae 2.0%
Drosophilidae 2.0%
Hodotermitidae 2.0%
Elmidae 2.0%
Armadillidiidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
8 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
9 2898741527 Sphingobacterium sp. xlx-73 Isolate
10 2904728850 Flavobacterium sp. xlx-214 Isolate
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
24 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
25 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
26 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
36 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
37 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
42 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
48 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
49 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
50 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
51 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_227579 3300042612 Bacteria 19902
2 Ga0466733_007439 3300042659 Bacteria 24356
3 Ga0068305_10090735 3300005083 Bacteria 1684
4 Ga0072941_1011534 3300005201 Bacteria 13536
5 Ga0466729_255688 3300042621 Bacteria 1633
6 Ga0466704_127111 3300042643 Bacteria 20765
7 Ga0466709_392548 3300042648 Bacteria 8367
8 Ga0466708_449216 3300042652 Bacteria 6706
9 Ga0466723_115142 3300042618 Bacteria 3601
10 Ga0466726_327898 3300042619 Bacteria 2077
11 Ga0160445_105929 3300012847 Bacteria 2039
12 Ga0264413_108093 3300024493 Bacteria 14472
13 Ga0466694_042635 3300042594 Bacteria 11852
14 Ga0466716_529705 3300042605 Bacteria 2193
15 Ga0466732_014040 3300042656 Bacteria 45614
16 Ga0466732_092386 3300042656 Bacteria 77086
17 Ga0466732_296993 3300042656 Bacteria 8020
18 JGI24695J34938_10005248 3300002450 Bacteria 8166
19 Ga0466703_262396 3300042636 Bacteria 45591
20 Ga0466709_132707 3300042648 Bacteria 6631
21 Ga0466724_41154 3300042649 Bacteria 40895
22 Ga0466715_026439 3300042616 Bacteria 28376
23 Ga0466715_180297 3300042616 Bacteria 7317
24 Ga0466723_292349 3300042618 Bacteria 9825
25 Ga0466728_019567 3300042620 Bacteria 33080
26 Ga0466728_095902 3300042620 Bacteria 11591
27 Ga0466728_462582 3300042620 Bacteria 6600
28 Ga0264413_121297 3300024493 Bacteria 9988
29 Ga0466692_119628 3300042591 Bacteria 3974
30 Ga0466722_030842 3300042609 Bacteria 2259
31 Ga0466722_154897 3300042609 Bacteria 1320
32 AustNasuHG_c1004222 3300000089 Bacteria 5157
33 Ga0074306_1118810 3300005309 Bacteria 1593
34 Ga0466703_107792 3300042636 Bacteria 2844
35 Ga0466704_255301 3300042643 Bacteria 11916
36 Ga0466724_08812 3300042649 Bacteria 122658
37 Ga0466715_200792 3300042616 Bacteria 39885
38 Ga0466726_374003 3300042619 Bacteria 5555
39 Ga0466690_263532 3300042590 Bacteria 1753
40 Ga0466692_069933 3300042591 Bacteria 10548
41 Ga0466692_147202 3300042591 Bacteria 3178
42 Ga0466694_054602 3300042594 Bacteria 16713
43 Ga0466696_110761 3300042596 Bacteria 3144
44 Ga0466719_420456 3300042606 Bacteria 4045
45 Ga0466705_121918 3300042612 Bacteria 14142
46 Ga0466735_148337 3300042624 Bacteria 1429
47 Ga0466703_042886 3300042636 Bacteria 4812
48 Ga0466703_412560 3300042636 Bacteria 1547
49 Ga0466704_092991 3300042643 Bacteria 30839
50 Ga0466709_005963 3300042648 Bacteria 3269
51 Ga0466711_098544 3300042615 Bacteria 10870
52 Ga0466711_251252 3300042615 Bacteria 11256
53 Ga0466715_330860 3300042616 Bacteria 6509
54 Ga0466690_403235 3300042590 Bacteria 2628
55 Ga0466691_014460 3300042593 Bacteria 3488
56 Ga0123357_10013501 3300009784 Bacteria 10608
57 Ga0466706_174667 3300042599 Bacteria 6525
58 Ga0466716_179228 3300042605 Bacteria 12127
59 Ga0466733_175745 3300042659 Unclassified 11156
60 Ga0466708_132352 3300042652 Bacteria 26395
61 Ga0466711_029169 3300042615 Bacteria 18598
62 Ga0466711_150667 3300042615 Bacteria 6994
63 Ga0466723_176382 3300042618 Bacteria 1107
64 Ga0415639_094856 3300038395 Bacteria 3669
65 Ga0466701_009184 3300042598 Bacteria 202780
66 Ga0466717_195807 3300042604 Bacteria 1287
67 Ga0466719_563885 3300042606 Bacteria 16233
68 Ga0466722_136631 3300042609 Bacteria 1381
69 Ga0466705_026302 3300042612 Bacteria 26376
70 Ga0466705_028386 3300042612 Bacteria 1592
71 Ga0466705_135880 3300042612 Bacteria 3922
72 JGI24698J34947_10000094 3300002449 Bacteria 30023
73 JGI24695J34938_10001546 3300002450 Bacteria 19404
74 Ga0068305_10001985 3300005083 Bacteria 26411
75 Ga0466703_366413 3300042636 Bacteria 3643
76 Ga0466704_378010 3300042643 Bacteria 2143
77 Ga0466724_60383 3300042649 Bacteria 43950
78 Ga0466718_103920 3300042617 Bacteria 11849
79 Ga0456237_0000655 3300041968 Bacteria 5306
80 Ga0466696_014649 3300042596 Bacteria 16965
81 Ga0466696_341286 3300042596 Bacteria 4509
82 Ga0466699_225518 3300042597 Bacteria 3379
83 Ga0123353_10336093 3300010167 Bacteria 2284
84 Ga0466706_017815 3300042599 Bacteria 4703
85 Ga0466700_221964 3300042600 Bacteria 2785
86 Ga0466717_129969 3300042604 Bacteria 2614
87 Ga0466716_123345 3300042605 Bacteria 4090
88 Ga0466721_013188 3300042608 Bacteria 2109
89 Ga0072940_1023898 3300005200 Bacteria 9424
90 Ga0466703_172824 3300042636 Bacteria 3026
91 Ga0466724_68115 3300042649 Bacteria 2859
92 Ga0466715_123507 3300042616 Bacteria 4059
93 Ga0466715_158340 3300042616 Bacteria 12847
94 Ga0466726_343021 3300042619 Bacteria 8390
95 Ga0264413_114716 3300024493 Bacteria 8027
96 Ga0466691_022783 3300042593 Bacteria 19111
97 Ga0466696_032233 3300042596 Bacteria 15007
98 Ga0466696_275188 3300042596 Bacteria 2227
99 Ga0466706_284328 3300042599 Bacteria 4129
100 Ga0466707_058183 3300042601 Bacteria 17108
101 Ga0466705_289305 3300042612 Bacteria 12990
102 JGI24695J34938_10001284 3300002450 Bacteria 22004
103 JGI24695J34938_10066918 3300002450 Bacteria 1513
104 Ga0466709_005524 3300042648 Bacteria 140810
105 Ga0466712_049167 3300042614 Bacteria 7498
106 Ga0466718_002524 3300042617 Bacteria 42896
107 Ga0466718_064535 3300042617 Bacteria 7862
108 Ga0466723_111100 3300042618 Bacteria 6483
109 Ga0466726_137600 3300042619 Bacteria 4964
110 Ga0466728_219019 3300042620 Bacteria 4908
111 Ga0264413_145620 3300024493 Bacteria 1751
112 Ga0466690_001303 3300042590 Bacteria 2423
113 Ga0466696_439510 3300042596 Bacteria 1862
114 Ga0123356_10015744 3300010049 Bacteria 7238
115 Ga0466706_028593 3300042599 Bacteria 1412
116 Ga0466716_391772 3300042605 Bacteria 2388
117 Ga0466719_491187 3300042606 Bacteria 6868
118 Ga0466722_116290 3300042609 Bacteria 6102
119 Ga0466722_137361 3300042609 Bacteria 2431

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_176382 Ga0466723_176382_87_947 286
2 3300042596 Ga0466696_275188 Ga0466696_275188_1249_2214 321
3 3300042606 Ga0466719_491187 Ga0466719_491187_5735_6706 323
4 3300042624 Ga0466735_148337 Ga0466735_148337_76_1080 334
5 3300042616 Ga0466715_158340 Ga0466715_158340_11655_12806 351
6 3300042656 Ga0466732_296993 Ga0466732_296993_6931_8004 357
7 3300042593 Ga0466691_022783 Ga0466691_022783_2626_3774 359
8 3300042659 Ga0466733_007439 Ga0466733_007439_16100_17239 359
9 3300042609 Ga0466722_154897 Ga0466722_154897_20_1111 363
10 3300042659 Ga0466733_175745 Ga0466733_175745_9954_11099 363
11 3300042612 Ga0466705_121918 Ga0466705_121918_10581_11729 365
12 3300042643 Ga0466704_378010 Ga0466704_378010_404_1552 365
13 3300042590 Ga0466690_001303 Ga0466690_001303_262_1365 367
14 3300042615 Ga0466711_029169 Ga0466711_029169_14598_15701 367
15 3300042652 Ga0466708_132352 Ga0466708_132352_2924_4027 367
16 3300042590 Ga0466690_263532 Ga0466690_263532_166_1272 368
17 3300042605 Ga0466716_123345 Ga0466716_123345_540_1646 368
18 3300042612 Ga0466705_227579 Ga0466705_227579_6772_7878 368
19 3300042636 Ga0466703_107792 Ga0466703_107792_452_1600 368
20 3300042643 Ga0466704_092991 Ga0466704_092991_11048_12154 368
21 3300042643 Ga0466704_127111 Ga0466704_127111_10829_11935 368
22 3300042593 Ga0466691_014460 Ga0466691_014460_1209_2357 369
23 3300042600 Ga0466700_221964 Ga0466700_221964_1623_2735 370
24 3300042601 Ga0466707_058183 Ga0466707_058183_5934_7046 370
25 3300042616 Ga0466715_330860 Ga0466715_330860_4370_5482 370
26 3300042618 Ga0466723_115142 Ga0466723_115142_1666_2778 370
27 3300042636 Ga0466703_412560 Ga0466703_412560_310_1422 370
28 3300042643 Ga0466704_255301 Ga0466704_255301_406_1518 370
29 3300042596 Ga0466696_014649 Ga0466696_014649_4149_5264 371
30 3300042598 Ga0466701_009184 Ga0466701_009184_67913_69028 371
31 3300042604 Ga0466717_129969 Ga0466717_129969_816_1931 371
32 3300042605 Ga0466716_179228 Ga0466716_179228_8425_9540 371
33 3300042606 Ga0466719_420456 Ga0466719_420456_759_1874 371
34 3300042614 Ga0466712_049167 Ga0466712_049167_3424_4539 371
35 3300042615 Ga0466711_251252 Ga0466711_251252_2872_3987 371
36 3300042620 Ga0466728_219019 Ga0466728_219019_1452_2567 371
37 3300042648 Ga0466709_005524 Ga0466709_005524_10855_11970 371
38 3300042649 Ga0466724_41154 Ga0466724_41154_27200_28315 371
39 3300042649 Ga0466724_60383 Ga0466724_60383_32576_33691 371
40 3300042649 Ga0466724_68115 Ga0466724_68115_1284_2399 371
41 3300010049 Ga0123356_10015744 Ga0123356_100157443 372
42 3300042649 Ga0466724_08812 Ga0466724_08812_98684_99802 372
43 iso_pr_bacteria 2811995047 2812947351 372
44 iso_pr_bacteria 2864891731 2864893204 372
45 iso_pr_bacteria 2898741527 2898745196 372
46 iso_pr_bacteria 2904728850 2904729241 372
47 iso_pr_bacteria 2921902974 2921904976 372
48 iso_pr_bacteria 2958471994 2958472484 372
49 3300005309 Ga0074306_1118810 Ga0074306_11188102 373
50 3300042604 Ga0466717_195807 Ga0466717_195807_94_1242 373
51 iso_pr_bacteria 2873776654 2873778342 373
52 3300005083 Ga0068305_10090735 Ga0068305_100907351 374
53 3300012847 Ga0160445_105929 Ga0160445_1059291 374
54 3300024493 Ga0264413_121297 Ga0264413_1212975 374
55 3300005200 Ga0072940_1023898 Ga0072940_10238988 375
56 3300042616 Ga0466715_180297 Ga0466715_180297_1757_2884 375
57 3300010167 Ga0123353_10336093 Ga0123353_103360932 376
58 3300042612 Ga0466705_026302 Ga0466705_026302_15835_16965 376
59 3300042619 Ga0466726_327898 Ga0466726_327898_929_2059 376
60 3300042648 Ga0466709_132707 Ga0466709_132707_2823_3953 376
61 3300042605 Ga0466716_529705 Ga0466716_529705_114_1247 377
62 3300042620 Ga0466728_019567 Ga0466728_019567_14018_15151 377
63 3300042621 Ga0466729_255688 Ga0466729_255688_80_1213 377
64 3300042648 Ga0466709_005963 Ga0466709_005963_958_2091 377
65 3300002450 JGI24695J34938_10005248 JGI24695J34938_100052484 378
66 3300042656 Ga0466732_014040 Ga0466732_014040_11941_13077 378
67 3300024493 Ga0264413_145620 Ga0264413_1456202 379
68 3300042605 Ga0466716_391772 Ga0466716_391772_65_1204 379
69 3300042606 Ga0466719_563885 Ga0466719_563885_11387_12526 379
70 3300042609 Ga0466722_030842 Ga0466722_030842_522_1661 379
71 3300042612 Ga0466705_289305 Ga0466705_289305_10087_11226 379
72 3300042615 Ga0466711_098544 Ga0466711_098544_6310_7449 379
73 3300042616 Ga0466715_026439 Ga0466715_026439_13709_14848 379
74 3300042616 Ga0466715_123507 Ga0466715_123507_1843_2982 379
75 3300042616 Ga0466715_200792 Ga0466715_200792_15075_16214 379
76 3300042618 Ga0466723_111100 Ga0466723_111100_1028_2167 379
77 3300042618 Ga0466723_292349 Ga0466723_292349_4003_5142 379
78 3300042648 Ga0466709_392548 Ga0466709_392548_4198_5337 379
79 3300042652 Ga0466708_449216 Ga0466708_449216_1850_2989 379
80 iso_pr_bacteria 2873610414 2873611924 379
81 3300002449 JGI24698J34947_10000094 JGI24698J34947_1000009427 380
82 3300002450 JGI24695J34938_10001284 JGI24695J34938_1000128413 380
83 3300002450 JGI24695J34938_10066918 JGI24695J34938_100669181 380
84 3300024493 Ga0264413_108093 Ga0264413_1080934 380
85 3300024493 Ga0264413_114716 Ga0264413_1147164 380
86 3300042591 Ga0466692_147202 Ga0466692_147202_48_1190 380
87 3300042617 Ga0466718_002524 Ga0466718_002524_24579_25721 380
88 3300042617 Ga0466718_064535 Ga0466718_064535_395_1537 380
89 3300042617 Ga0466718_103920 Ga0466718_103920_7595_8737 380
90 3300042619 Ga0466726_343021 Ga0466726_343021_82_1224 380
91 3300042656 Ga0466732_092386 Ga0466732_092386_42614_43756 380
92 iso_pr_bacteria 2695420931 2698112170 380
93 3300042597 Ga0466699_225518 Ga0466699_225518_579_1724 381
94 3300005201 Ga0072941_1011534 Ga0072941_101153410 382
95 3300041968 Ga0456237_0000655 Ga0456237_0000655_4085_5233 382
96 3300042591 Ga0466692_069933 Ga0466692_069933_153_1301 382
97 3300042594 Ga0466694_042635 Ga0466694_042635_1770_2918 382
98 3300042596 Ga0466696_032233 Ga0466696_032233_5981_7129 382
99 3300042596 Ga0466696_110761 Ga0466696_110761_1843_2991 382
100 3300042596 Ga0466696_439510 Ga0466696_439510_294_1442 382
101 3300042608 Ga0466721_013188 Ga0466721_013188_903_2051 382
102 3300042612 Ga0466705_135880 Ga0466705_135880_483_1631 382
103 3300042615 Ga0466711_150667 Ga0466711_150667_1123_2271 382
104 3300042619 Ga0466726_137600 Ga0466726_137600_2325_3473 382
105 3300042619 Ga0466726_374003 Ga0466726_374003_139_1287 382
106 3300042620 Ga0466728_095902 Ga0466728_095902_5959_7107 382
107 3300042636 Ga0466703_042886 Ga0466703_042886_721_1869 382
108 3300042636 Ga0466703_172824 Ga0466703_172824_262_1410 382
109 3300000089 AustNasuHG_c1004222 AustNasuHG_10042223 383
110 3300002450 JGI24695J34938_10001546 JGI24695J34938_100015467 383
111 3300009784 Ga0123357_10013501 Ga0123357_100135017 383
112 3300042596 Ga0466696_341286 Ga0466696_341286_1538_2689 383
113 3300042609 Ga0466722_137361 Ga0466722_137361_270_1421 383
114 3300042612 Ga0466705_028386 Ga0466705_028386_326_1477 383
115 3300042636 Ga0466703_262396 Ga0466703_262396_2757_3908 383
116 3300042636 Ga0466703_366413 Ga0466703_366413_1731_2882 383
117 3300042591 Ga0466692_119628 Ga0466692_119628_500_1654 384
118 3300042609 Ga0466722_116290 Ga0466722_116290_3750_4904 384
119 3300042609 Ga0466722_136631 Ga0466722_136631_201_1355 384
120 3300042599 Ga0466706_017815 Ga0466706_017815_3214_4374 386
121 3300042599 Ga0466706_174667 Ga0466706_174667_4647_5807 386
122 3300042599 Ga0466706_284328 Ga0466706_284328_2367_3527 386
123 3300005083 Ga0068305_10001985 Ga0068305_1000198521 387
124 3300042594 Ga0466694_054602 Ga0466694_054602_7761_8924 387
125 3300042599 Ga0466706_028593 Ga0466706_028593_210_1382 390
126 3300038395 Ga0415639_094856 Ga0415639_094856_950_2125 391
127 3300042590 Ga0466690_403235 Ga0466690_403235_125_1303 392
128 3300042620 Ga0466728_462582 Ga0466728_462582_5385_6563 392

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 44 115 0.87
PF01370 Epimerase NAD dependent epimerase/dehydratase family 11 170 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.