Protein Family IF04571

Metagenome Isolate
222 Members
92 Samples
200 Scaffolds
289.6 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_329801|Ga0466690_329801_497_1531
Length
344 aa
Sequence
VIIFFEVDKKVDFEIKKEGFDFYYMHLEILNFHVTLHFICKCSKKIVGKMETADLLKKVRKIEIKTKGLSGNIFAGEYHSAFKGRGMTFSEVREYQPGDDVRNIDWNVTARFNTPFVKVFEEERELTVMLIIDVSASESFGTQSKFKKDLIAELSAVLSFSASINNDKIGAMFFGSKVEKFIPPQKGRTHILRIIREILEFTPENSGTNISEALAYLTGALKKRCTTFILSDFMDFDENNMPCFEQALKIASKKHDVVALRIFDQREKELPPVGLIEMYDAETGQSVLVNTNRKKNRKIYNNWWNTCSDNLNKIFSKYKVDSVNIATDDDYIKPLVKLFKKRAV

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.2%
Unclassified 18.4%
Kalotermitidae 16.1%
Formicidae 9.2%
Drosophilidae 4.6%
Rhinotermitidae 3.4%
Termopsidae 3.4%
Elmidae 2.3%
Passalidae 2.3%
Armadillidiidae 1.1%
Tenebrionidae 1.1%
Daphniidae 1.1%
Hodotermitidae 1.1%
Nephropidae 1.1%
Cambaridae 1.1%
Kiwaidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 207
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
2 2820786992 Unclassified Bacteroidetes Emb289P1bin66 Isolate Unclassified
3 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
4 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
5 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
6 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
7 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
8 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
9 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
10 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
11 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
16 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
17 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
18 2904728850 Flavobacterium sp. xlx-214 Isolate
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
26 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
31 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
32 2882250448 Bizionia sp. APA-3 Isolate
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
37 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
38 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
39 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
47 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
48 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
49 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
50 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
51 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
52 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
53 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
54 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
55 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
56 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
57 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
58 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
59 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
60 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
61 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
62 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
63 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
64 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
65 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
66 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
67 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
68 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
69 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
70 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
71 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
72 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
73 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
74 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
75 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
76 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
77 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
78 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
79 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
80 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
81 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
82 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
83 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
84 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
85 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
86 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
87 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
88 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
89 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
90 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
91 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
92 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_237112 3300042611 Bacteria 5222
2 Ga0466705_010291 3300042612 Bacteria 7078
3 Ga0466705_133667 3300042612 Bacteria 38257
4 Ga0466705_254607 3300042612 Bacteria 1563
5 Ga0466733_153087 3300042659 Bacteria 3270
6 Ga0102735_1003178 3300007080 Bacteria 2347
7 Ga0104048_1004004 3300007143 Bacteria 12426
8 Ga0466715_025272 3300042616 Bacteria 13623
9 Ga0466701_082893 3300042598 Bacteria 37923
10 Ga0466706_017943 3300042599 Bacteria 35858
11 Ga0466714_042148 3300042603 Bacteria 2773
12 Ga0466714_043463 3300042603 Bacteria 6651
13 Ga0466714_087391 3300042603 Bacteria 1560
14 Ga0466719_524590 3300042606 Bacteria 5476
15 Ga0466720_134367 3300042607 Bacteria 2431
16 Ga0466697_016413 3300042611 Bacteria 1982
17 Ga0123353_10009288 3300010167 Bacteria 13545
18 Ga0123354_10283885 3300010882 Bacteria 1601
19 Ga0160464_100081 3300012805 Bacteria 110703
20 Ga0466657_089160 3300042582 Unclassified 3032
21 Ga0466703_243709 3300042636 Bacteria 10168
22 Ga0466708_046779 3300042652 Bacteria 15632
23 Ga0466733_118931 3300042659 Bacteria 23201
24 JGI24695J34938_10034110 3300002450 Bacteria 2336
25 Ga0068302_10008735 3300005071 Bacteria 6359
26 Ga0068305_10068494 3300005083 Bacteria 37295
27 Ga0104048_1171448 3300007143 Bacteria 1482
28 Ga0103267_1006937 3300007190 Bacteria 5101
29 Ga0466710_440248 3300042613 Bacteria 5620
30 Ga0466711_104293 3300042615 Bacteria 9463
31 Ga0466701_069250 3300042598 Bacteria 2110
32 Ga0466714_038352 3300042603 Bacteria 65655
33 Ga0466714_161762 3300042603 Bacteria 2370
34 Ga0466716_215211 3300042605 Bacteria 2135
35 Ga0466722_176256 3300042609 Bacteria 2154
36 Ga0123356_10599052 3300010049 Unclassified 1267
37 Ga0123353_10219152 3300010167 Bacteria 2977
38 Ga0123353_10467866 3300010167 Bacteria 1849
39 Ga0123353_10820464 3300010167 Bacteria 1281
40 Ga0123353_11064821 3300010167 Bacteria 1078
41 Ga0123353_11265525 3300010167 Bacteria 961
42 Ga0160457_1001675 3300012858 Bacteria 5671
43 Ga0466694_296134 3300042594 Bacteria 15761
44 Ga0466695_244338 3300042595 Bacteria 1331
45 Ga0466696_395311 3300042596 Bacteria 10238
46 Ga0466703_017988 3300042636 Bacteria 8088
47 Ga0466727_211710 3300042655 Bacteria 6245
48 IMNBL1DRAFT_c0022028 3300000062 Bacteria 2532
49 JGI24702J35022_10013055 3300002462 Bacteria 4608
50 Ga0068302_10013229 3300005071 Bacteria 5843
51 Ga0102737_1000052 3300007142 Bacteria 34662
52 Ga0466705_488092 3300042612 Bacteria 21416
53 Ga0466711_018792 3300042615 Bacteria 12875
54 Ga0466715_273774 3300042616 Bacteria 12241
55 Ga0466723_330251 3300042618 Bacteria 6137
56 Ga0466701_077142 3300042598 Bacteria 16041
57 Ga0466716_354110 3300042605 Bacteria 6364
58 Ga0466722_141618 3300042609 Bacteria 12339
59 Ga0466722_151148 3300042609 Bacteria 4280
60 Ga0123354_10247272 3300010882 Bacteria 1817
61 Ga0157631_122095 3300013007 Bacteria 2593
62 Ga0415639_064994 3300038395 Unclassified 2067
63 Ga0466690_157295 3300042590 Bacteria 5196
64 Ga0466692_064682 3300042591 Bacteria 2653
65 Ga0466691_019459 3300042593 Bacteria 12063
66 Ga0466691_055360 3300042593 Bacteria 60253
67 Ga0466691_118583 3300042593 Bacteria 5146
68 Ga0466696_269227 3300042596 Bacteria 6396
69 Ga0466731_000856 3300042622 Bacteria 2969
70 Ga0466703_362470 3300042636 Bacteria 4438
71 Ga0466697_225443 3300042611 Bacteria 1034
72 IMNBL1DRAFT_c0004837 3300000062 Bacteria 7940
73 Ga0466710_093950 3300042613 Bacteria 1674
74 Ga0466710_326489 3300042613 Bacteria 3198
75 Ga0466712_286395 3300042614 Bacteria 1259
76 Ga0466715_065955 3300042616 Bacteria 4203
77 Ga0466701_021588 3300042598 Bacteria 47878
78 Ga0466713_101459 3300042602 Bacteria 26532
79 Ga0466717_144505 3300042604 Unclassified 1269
80 Ga0466722_268669 3300042609 Bacteria 10988
81 Ga0123355_10090818 3300009826 Bacteria 4844
82 Ga0123353_10015319 3300010167 Bacteria 11127
83 Ga0123354_10045316 3300010882 Unclassified 6731
84 Ga0466657_100498 3300042582 Bacteria 18371
85 Ga0466657_222210 3300042582 Bacteria 2802
86 Ga0466690_101320 3300042590 Unclassified 1699
87 Ga0466692_108411 3300042591 Bacteria 15895
88 Ga0466731_383201 3300042622 Bacteria 1200
89 Ga0466703_029191 3300042636 Bacteria 4361
90 Ga0466703_126686 3300042636 Bacteria 2586
91 Ga0466704_497889 3300042643 Bacteria 43988
92 Ga0466697_066136 3300042611 Bacteria 3416
93 Ga0466705_052613 3300042612 Unclassified 6785
94 Ga0466733_157359 3300042659 Bacteria 5024
95 JGI24702J35022_10000261 3300002462 Bacteria 30179
96 JGI24696J40584_12941644 3300002834 Unclassified 1715
97 Ga0104045_1001140 3300007085 Bacteria 13426
98 Ga0102734_1000385 3300007129 Bacteria 12777
99 Ga0466710_264452 3300042613 Bacteria 3812
100 Ga0466723_238207 3300042618 Bacteria 6901
101 Ga0466726_097810 3300042619 Unclassified 4565
102 Ga0466707_390112 3300042601 Bacteria 4247
103 Ga0466716_178779 3300042605 Bacteria 7809
104 Ga0466698_417227 3300042610 Bacteria 2481
105 Ga0123356_10003831 3300010049 Bacteria 15662
106 Ga0123353_10000454 3300010167 Bacteria 50966
107 Ga0123354_10008581 3300010882 Bacteria 15551
108 Ga0466696_080985 3300042596 Bacteria 38621
109 Ga0466696_168122 3300042596 Bacteria 10947
110 Ga0466731_231068 3300042622 Bacteria 3899
111 Ga0466731_403034 3300042622 Bacteria 1925
112 Ga0466709_081885 3300042648 Bacteria 5993
113 Ga0466724_28891 3300042649 Bacteria 455231
114 Ga0466732_372506 3300042656 Bacteria 121204
115 Ga0466733_013242 3300042659 Unclassified 2083
116 Ga0466733_109902 3300042659 Bacteria 2843
117 Ga0466733_163016 3300042659 Bacteria 5575
118 JGI24702J35022_10143589 3300002462 Bacteria 1334
119 JGI24705J35276_12161214 3300002504 Bacteria 1234
120 Ga0103265_1000086 3300007068 Bacteria 18456
121 Ga0102739_1000052 3300007095 Bacteria 32705
122 Ga0104048_1000550 3300007143 Bacteria 5915
123 Ga0104048_1020704 3300007143 Bacteria 2871
124 Ga0104019_1001182 3300007150 Unclassified 1873
125 Ga0466711_185108 3300042615 Bacteria 11364
126 Ga0466723_082387 3300042618 Unclassified 5014
127 Ga0466723_293502 3300042618 Bacteria 25263
128 Ga0466729_140215 3300042621 Bacteria 1911
129 Ga0466701_057256 3300042598 Bacteria 13549
130 Ga0466713_133699 3300042602 Bacteria 32062
131 Ga0466714_005006 3300042603 Bacteria 5069
132 Ga0466714_005050 3300042603 Bacteria 21343
133 Ga0466714_046228 3300042603 Bacteria 4231
134 Ga0466714_064802 3300042603 Bacteria 1658
135 Ga0466714_071053 3300042603 Bacteria 2857
136 Ga0466719_210528 3300042606 Bacteria 7747
137 Ga0123353_10037734 3300010167 Bacteria 7582
138 Ga0123353_10204089 3300010167 Bacteria 3106
139 Ga0466690_009509 3300042590 Bacteria 6421
140 Ga0466690_115158 3300042590 Bacteria 8803
141 Ga0466731_253235 3300042622 Bacteria 51566
142 Ga0466734_002649 3300042623 Bacteria 1499
143 Ga0466704_136608 3300042643 Bacteria 15825
144 Ga0466697_281357 3300042611 Bacteria 2576
145 IMNBGM34_c002990 3300000036 Bacteria 2380
146 IMNBGM34_c007540 3300000036 Bacteria 1400
147 JGI24696J40584_12936609 3300002834 Bacteria 1584
148 Ga0074308_1113558 3300005307 Bacteria 3424
149 Ga0103268_1000027 3300007192 Bacteria 47563
150 Ga0466705_422513 3300042612 Bacteria 14401
151 Ga0466705_504587 3300042612 Bacteria 4248
152 Ga0466723_238649 3300042618 Unclassified 15901
153 Ga0466728_250187 3300042620 Bacteria 12493
154 Ga0466729_091428 3300042621 Bacteria 10013
155 Ga0466701_102031 3300042598 Bacteria 201577
156 Ga0466714_101423 3300042603 Bacteria 1645
157 Ga0466716_031032 3300042605 Bacteria 4802
158 Ga0466722_147201 3300042609 Bacteria 28195
159 Ga0123354_10134117 3300010882 Bacteria 3108
160 Ga0160431_101799 3300012828 Bacteria 5647
161 Ga0466657_016523 3300042582 Bacteria 6840
162 Ga0466690_301325 3300042590 Bacteria 3853
163 Ga0466731_047117 3300042622 Bacteria 1664
164 Ga0466704_421149 3300042643 Bacteria 33743
165 Ga0466704_473467 3300042643 Unclassified 3481
166 Ga0466708_073613 3300042652 Bacteria 4298
167 Ga0466708_122528 3300042652 Bacteria 19009
168 Ga0466727_059142 3300042655 Bacteria 16224
169 Ga0466697_262029 3300042611 Bacteria 1966
170 Ga0466732_304541 3300042656 Bacteria 4819
171 Ga0466732_354839 3300042656 Bacteria 2507
172 Ga0466732_417766 3300042656 Bacteria 2789
173 JGI24695J34938_10004781 3300002450 Bacteria 8719
174 JGI24702J35022_10005067 3300002462 Bacteria 7757
175 CVPL010W_10001888 3300002931 Bacteria 45788
176 Ga0103267_1001135 3300007190 Bacteria 6607
177 Ga0466710_214354 3300042613 Bacteria 1899
178 Ga0466726_448249 3300042619 Unclassified 2682
179 Ga0466728_264615 3300042620 Bacteria 7345
180 Ga0466706_029599 3300042599 Bacteria 23165
181 Ga0466706_177292 3300042599 Bacteria 3664
182 Ga0466700_015001 3300042600 Bacteria 10860
183 Ga0466717_162587 3300042604 Bacteria 3917
184 Ga0466719_386066 3300042606 Bacteria 1461
185 Ga0466720_196164 3300042607 Bacteria 2279
186 Ga0466698_032574 3300042610 Bacteria 1058
187 Ga0123356_10005976 3300010049 Bacteria 12349
188 Ga0123353_10002109 3300010167 Bacteria 24588
189 Ga0123353_10173923 3300010167 Bacteria 3416
190 Ga0123354_10396776 3300010882 Bacteria 1173
191 Ga0466690_269579 3300042590 Bacteria 4837
192 Ga0466690_329801 3300042590 Bacteria 5195
193 Ga0466692_088232 3300042591 Bacteria 3025
194 Ga0466693_071824 3300042592 Bacteria 1388
195 Ga0466691_019039 3300042593 Bacteria 15517
196 Ga0466695_258278 3300042595 Bacteria 3688
197 Ga0466696_213488 3300042596 Bacteria 5031
198 Ga0466699_021565 3300042597 Bacteria 4075
199 Ga0466724_31863 3300042649 Bacteria 2420
200 Ga0466724_53060 3300042649 Bacteria 1311

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042595 Ga0466695_244338 Ga0466695_244338_10_810 247
2 3300042582 Ga0466657_016523 Ga0466657_016523_35_787 250
3 3300042611 Ga0466697_225443 Ga0466697_225443_260_1012 250
4 3300038395 Ga0415639_064994 Ga0415639_064994_1240_1998 252
5 3300042611 Ga0466697_066136 Ga0466697_066136_27_785 252
6 3300042649 Ga0466724_53060 Ga0466724_53060_543_1301 252
7 3300010049 Ga0123356_10003831 Ga0123356_1000383112 253
8 3300042599 Ga0466706_029599 Ga0466706_029599_747_1514 255
9 3300042599 Ga0466706_177292 Ga0466706_177292_953_1720 255
10 3300042603 Ga0466714_071053 Ga0466714_071053_1285_2052 255
11 3300042659 Ga0466733_013242 Ga0466733_013242_19_786 255
12 3300042656 Ga0466732_372506 Ga0466732_372506_98861_99730 265
13 3300042613 Ga0466710_214354 Ga0466710_214354_559_1359 266
14 3300042649 Ga0466724_28891 Ga0466724_28891_426518_427381 272
15 3300042643 Ga0466704_421149 Ga0466704_421149_12404_13273 274
16 3300010167 Ga0123353_10015319 Ga0123353_100153194 277
17 3300042656 Ga0466732_304541 Ga0466732_304541_1502_2371 280
18 3300042656 Ga0466732_417766 Ga0466732_417766_1929_2777 282
19 3300042590 Ga0466690_009509 Ga0466690_009509_3385_4245 286
20 3300042593 Ga0466691_055360 Ga0466691_055360_36544_37404 286
21 3300042596 Ga0466696_213488 Ga0466696_213488_838_1698 286
22 3300042602 Ga0466713_133699 Ga0466713_133699_13646_14506 286
23 3300042603 Ga0466714_043463 Ga0466714_043463_4203_5063 286
24 3300042606 Ga0466719_210528 Ga0466719_210528_1927_2787 286
25 3300042636 Ga0466703_362470 Ga0466703_362470_2971_3831 286
26 3300042582 Ga0466657_100498 Ga0466657_100498_17491_18354 287
27 3300042582 Ga0466657_222210 Ga0466657_222210_101_964 287
28 3300042595 Ga0466695_258278 Ga0466695_258278_1660_2523 287
29 3300042598 Ga0466701_021588 Ga0466701_021588_18686_19549 287
30 3300042598 Ga0466701_082893 Ga0466701_082893_24924_25787 287
31 3300042598 Ga0466701_102031 Ga0466701_102031_29189_30052 287
32 3300042600 Ga0466700_015001 Ga0466700_015001_8080_8943 287
33 3300042609 Ga0466722_141618 Ga0466722_141618_3898_4761 287
34 3300042611 Ga0466697_016413 Ga0466697_016413_1017_1880 287
35 3300042613 Ga0466710_440248 Ga0466710_440248_4269_5132 287
36 3300042623 Ga0466734_002649 Ga0466734_002649_393_1256 287
37 iso_pr_bacteria 2811995047 2812947281 287
38 iso_pr_bacteria 2820746860 2820747089 287
39 iso_pr_bacteria 2820770630 2820772184 287
40 iso_pr_bacteria 2820786992 2820787616 287
41 iso_pr_bacteria 2864878056 2864878271 287
42 iso_pr_bacteria 2864886855 2864888043 287
43 iso_pr_bacteria 2899132286 2899132755 287
44 iso_pr_bacteria 2904728850 2904728945 287
45 iso_pr_bacteria 2958471994 2958472090 287
46 3300002450 JGI24695J34938_10034110 JGI24695J34938_100341103 288
47 3300002931 CVPL010W_10001888 CVPL010W_100018889 288
48 3300005307 Ga0074308_1113558 Ga0074308_11135582 288
49 3300007068 Ga0103265_1000086 Ga0103265_10000864 288
50 3300007080 Ga0102735_1003178 Ga0102735_10031783 288
51 3300007085 Ga0104045_1001140 Ga0104045_10011403 288
52 3300007095 Ga0102739_1000052 Ga0102739_100005219 288
53 3300007129 Ga0102734_1000385 Ga0102734_10003859 288
54 3300007142 Ga0102737_1000052 Ga0102737_100005210 288
55 3300007143 Ga0104048_1000550 Ga0104048_10005502 288
56 3300007143 Ga0104048_1004004 Ga0104048_10040046 288
57 3300007143 Ga0104048_1171448 Ga0104048_11714481 288
58 3300007150 Ga0104019_1001182 Ga0104019_10011822 288
59 3300007190 Ga0103267_1001135 Ga0103267_10011355 288
60 3300007192 Ga0103268_1000027 Ga0103268_100002733 288
61 3300009826 Ga0123355_10090818 Ga0123355_100908183 288
62 3300010167 Ga0123353_10002109 Ga0123353_100021099 288
63 3300042591 Ga0466692_088232 Ga0466692_088232_1329_2195 288
64 3300042610 Ga0466698_032574 Ga0466698_032574_141_1007 288
65 3300042611 Ga0466697_281357 Ga0466697_281357_317_1183 288
66 3300042612 Ga0466705_010291 Ga0466705_010291_1142_2008 288
67 3300042621 Ga0466729_091428 Ga0466729_091428_8375_9241 288
68 3300042622 Ga0466731_047117 Ga0466731_047117_499_1365 288
69 3300042656 Ga0466732_354839 Ga0466732_354839_1472_2338 288
70 3300042659 Ga0466733_118931 Ga0466733_118931_7409_8275 288
71 3300042659 Ga0466733_157359 Ga0466733_157359_2776_3642 288
72 iso_pr_bacteria 2718218155 2720328580 288
73 iso_pr_bacteria 2820785563 2820786135 288
74 iso_pr_bacteria 2820788205 2820788619 288
75 iso_pr_bacteria 2838772460 2838772896 288
76 iso_pr_bacteria 2882250448 2882250558 288
77 iso_pr_bacteria 2894649344 2894650082 288
78 3300002462 JGI24702J35022_10013055 JGI24702J35022_100130554 289
79 3300002834 JGI24696J40584_12941644 JGI24696J40584_129416442 289
80 3300010167 Ga0123353_10219152 Ga0123353_102191524 289
81 3300013007 Ga0157631_122095 Ga0157631_1220952 289
82 3300042582 Ga0466657_089160 Ga0466657_089160_1113_1982 289
83 3300042592 Ga0466693_071824 Ga0466693_071824_430_1299 289
84 3300042594 Ga0466694_296134 Ga0466694_296134_8163_9032 289
85 3300042598 Ga0466701_057256 Ga0466701_057256_9858_10727 289
86 3300042598 Ga0466701_069250 Ga0466701_069250_597_1466 289
87 3300042598 Ga0466701_077142 Ga0466701_077142_903_1772 289
88 3300042599 Ga0466706_017943 Ga0466706_017943_15675_16544 289
89 3300042603 Ga0466714_038352 Ga0466714_038352_22104_22973 289
90 3300042604 Ga0466717_162587 Ga0466717_162587_1980_2849 289
91 3300042607 Ga0466720_134367 Ga0466720_134367_300_1169 289
92 3300042607 Ga0466720_196164 Ga0466720_196164_1357_2226 289
93 3300042610 Ga0466698_417227 Ga0466698_417227_1436_2305 289
94 3300042611 Ga0466697_237112 Ga0466697_237112_672_1541 289
95 3300042612 Ga0466705_488092 Ga0466705_488092_1056_1925 289
96 3300042613 Ga0466710_093950 Ga0466710_093950_296_1165 289
97 3300042613 Ga0466710_326489 Ga0466710_326489_55_924 289
98 3300042622 Ga0466731_000856 Ga0466731_000856_986_1855 289
99 3300042622 Ga0466731_231068 Ga0466731_231068_2441_3310 289
100 3300042622 Ga0466731_253235 Ga0466731_253235_19986_20855 289
101 3300042622 Ga0466731_383201 Ga0466731_383201_59_928 289
102 3300042622 Ga0466731_403034 Ga0466731_403034_202_1071 289
103 3300042649 Ga0466724_31863 Ga0466724_31863_910_1779 289
104 iso_pr_bacteria 2820735654 2820735666 289
105 iso_pr_bacteria 2820753519 2820754515 289
106 iso_pr_bacteria 2820755292 2820756952 289
107 iso_pr_bacteria 2820789850 2820790265 289
108 iso_pr_bacteria 2820792843 2820793163 289
109 iso_pr_bacteria 2820795054 2820797568 289
110 iso_pr_bacteria 2820797595 2820798790 289
111 3300000062 IMNBL1DRAFT_c0022028 IMNBL1DRAFT_00220283 290
112 3300002450 JGI24695J34938_10004781 JGI24695J34938_100047813 290
113 3300002462 JGI24702J35022_10000261 JGI24702J35022_1000026114 290
114 3300002462 JGI24702J35022_10005067 JGI24702J35022_100050672 290
115 3300002462 JGI24702J35022_10143589 JGI24702J35022_101435892 290
116 3300002504 JGI24705J35276_12161214 JGI24705J35276_121612141 290
117 3300002834 JGI24696J40584_12936609 JGI24696J40584_129366092 290
118 3300005083 Ga0068305_10068494 Ga0068305_1006849420 290
119 3300007190 Ga0103267_1006937 Ga0103267_10069375 290
120 3300010049 Ga0123356_10005976 Ga0123356_100059766 290
121 3300010049 Ga0123356_10599052 Ga0123356_105990521 290
122 3300010167 Ga0123353_10000454 Ga0123353_100004543 290
123 3300010167 Ga0123353_10037734 Ga0123353_100377342 290
124 3300010167 Ga0123353_10204089 Ga0123353_102040892 290
125 3300010167 Ga0123353_10467866 Ga0123353_104678662 290
126 3300010167 Ga0123353_11064821 Ga0123353_110648211 290
127 3300010167 Ga0123353_11265525 Ga0123353_112655251 290
128 3300010882 Ga0123354_10008581 Ga0123354_100085812 290
129 3300010882 Ga0123354_10045316 Ga0123354_100453161 290
130 3300010882 Ga0123354_10134117 Ga0123354_101341173 290
131 3300010882 Ga0123354_10247272 Ga0123354_102472722 290
132 3300010882 Ga0123354_10283885 Ga0123354_102838851 290
133 3300042604 Ga0466717_144505 Ga0466717_144505_137_1009 290
134 3300042615 Ga0466711_018792 Ga0466711_018792_3924_4796 290
135 3300042616 Ga0466715_065955 Ga0466715_065955_2596_3468 290
136 3300010167 Ga0123353_10009288 Ga0123353_1000928811 291
137 3300012805 Ga0160464_100081 Ga0160464_10008156 292
138 3300012828 Ga0160431_101799 Ga0160431_1017994 292
139 3300042621 Ga0466729_140215 Ga0466729_140215_328_1206 292
140 3300010882 Ga0123354_10396776 Ga0123354_103967761 293
141 3300042591 Ga0466692_064682 Ga0466692_064682_933_1814 293
142 3300042597 Ga0466699_021565 Ga0466699_021565_682_1563 293
143 3300042603 Ga0466714_005006 Ga0466714_005006_3401_4282 293
144 3300042603 Ga0466714_005050 Ga0466714_005050_17638_18519 293
145 3300042603 Ga0466714_042148 Ga0466714_042148_458_1339 293
146 3300042603 Ga0466714_046228 Ga0466714_046228_68_949 293
147 3300042603 Ga0466714_064802 Ga0466714_064802_326_1207 293
148 3300042603 Ga0466714_087391 Ga0466714_087391_640_1521 293
149 3300042603 Ga0466714_161762 Ga0466714_161762_180_1061 293
150 3300042614 Ga0466712_286395 Ga0466712_286395_367_1248 293
151 3300042643 Ga0466704_497889 Ga0466704_497889_33063_33944 293
152 3300000036 IMNBGM34_c002990 IMNBGM34_0029902 294
153 3300000036 IMNBGM34_c007540 IMNBGM34_0075401 294
154 3300012858 Ga0160457_1001675 Ga0160457_10016754 294
155 3300042590 Ga0466690_157295 Ga0466690_157295_4050_4934 294
156 3300042591 Ga0466692_108411 Ga0466692_108411_5962_6846 294
157 3300042596 Ga0466696_168122 Ga0466696_168122_8516_9400 294
158 3300042603 Ga0466714_101423 Ga0466714_101423_115_999 294
159 3300042609 Ga0466722_147201 Ga0466722_147201_11508_12392 294
160 3300042609 Ga0466722_176256 Ga0466722_176256_936_1820 294
161 3300042609 Ga0466722_268669 Ga0466722_268669_2728_3612 294
162 3300042612 Ga0466705_052613 Ga0466705_052613_990_1874 294
163 3300042612 Ga0466705_422513 Ga0466705_422513_7506_8390 294
164 3300042615 Ga0466711_185108 Ga0466711_185108_10031_10915 294
165 3300042619 Ga0466726_097810 Ga0466726_097810_3277_4161 294
166 3300042619 Ga0466726_448249 Ga0466726_448249_14_898 294
167 3300042655 Ga0466727_059142 Ga0466727_059142_7870_8754 294
168 3300042655 Ga0466727_211710 Ga0466727_211710_2931_3815 294
169 3300042659 Ga0466733_153087 Ga0466733_153087_906_1790 294
170 3300042659 Ga0466733_163016 Ga0466733_163016_3565_4449 294
171 3300000062 IMNBL1DRAFT_c0004837 IMNBL1DRAFT_00048374 295
172 3300005071 Ga0068302_10008735 Ga0068302_100087352 295
173 3300007143 Ga0104048_1020704 Ga0104048_10207042 295
174 3300042590 Ga0466690_115158 Ga0466690_115158_1846_2733 295
175 3300042590 Ga0466690_301325 Ga0466690_301325_844_1731 295
176 3300042593 Ga0466691_019039 Ga0466691_019039_6738_7625 295
177 3300042596 Ga0466696_080985 Ga0466696_080985_37415_38302 295
178 3300042596 Ga0466696_269227 Ga0466696_269227_4507_5394 295
179 3300042596 Ga0466696_395311 Ga0466696_395311_6793_7680 295
180 3300042601 Ga0466707_390112 Ga0466707_390112_1952_2839 295
181 3300042605 Ga0466716_031032 Ga0466716_031032_351_1238 295
182 3300042605 Ga0466716_215211 Ga0466716_215211_1167_2054 295
183 3300042605 Ga0466716_354110 Ga0466716_354110_876_1763 295
184 3300042606 Ga0466719_386066 Ga0466719_386066_445_1332 295
185 3300042606 Ga0466719_524590 Ga0466719_524590_3962_4849 295
186 3300042609 Ga0466722_151148 Ga0466722_151148_3121_4008 295
187 3300042612 Ga0466705_254607 Ga0466705_254607_183_1070 295
188 3300042612 Ga0466705_504587 Ga0466705_504587_3246_4133 295
189 3300042616 Ga0466715_025272 Ga0466715_025272_10083_10970 295
190 3300042616 Ga0466715_273774 Ga0466715_273774_8798_9685 295
191 3300042618 Ga0466723_082387 Ga0466723_082387_4083_4970 295
192 3300042618 Ga0466723_238207 Ga0466723_238207_2258_3145 295
193 3300042618 Ga0466723_238649 Ga0466723_238649_12162_13049 295
194 3300042618 Ga0466723_293502 Ga0466723_293502_18226_19113 295
195 3300042618 Ga0466723_330251 Ga0466723_330251_4859_5746 295
196 3300042620 Ga0466728_250187 Ga0466728_250187_10325_11212 295
197 3300042620 Ga0466728_264615 Ga0466728_264615_53_940 295
198 3300042636 Ga0466703_017988 Ga0466703_017988_6751_7638 295
199 3300042636 Ga0466703_126686 Ga0466703_126686_1605_2492 295
200 3300042636 Ga0466703_243709 Ga0466703_243709_6863_7750 295
201 3300042643 Ga0466704_473467 Ga0466704_473467_2273_3160 295
202 3300042648 Ga0466709_081885 Ga0466709_081885_1294_2181 295
203 3300042652 Ga0466708_122528 Ga0466708_122528_2127_3014 295
204 3300042659 Ga0466733_109902 Ga0466733_109902_637_1524 295
205 3300005071 Ga0068302_10013229 Ga0068302_100132291 296
206 3300042615 Ga0466711_104293 Ga0466711_104293_471_1361 296
207 3300042593 Ga0466691_019459 Ga0466691_019459_10159_11052 297
208 3300042605 Ga0466716_178779 Ga0466716_178779_2671_3564 297
209 3300042612 Ga0466705_133667 Ga0466705_133667_18954_19847 297
210 3300042636 Ga0466703_029191 Ga0466703_029191_289_1182 297
211 3300042643 Ga0466704_136608 Ga0466704_136608_9972_10865 297
212 3300042652 Ga0466708_073613 Ga0466708_073613_1298_2191 297
213 3300042593 Ga0466691_118583 Ga0466691_118583_3938_4849 303
214 3300042611 Ga0466697_262029 Ga0466697_262029_243_1163 306
215 3300010167 Ga0123353_10173923 Ga0123353_101739233 307
216 3300042613 Ga0466710_264452 Ga0466710_264452_2792_3724 310
217 3300042590 Ga0466690_101320 Ga0466690_101320_69_1004 311
218 3300010167 Ga0123353_10820464 Ga0123353_108204642 315
219 3300042602 Ga0466713_101459 Ga0466713_101459_23034_24035 316
220 3300042652 Ga0466708_046779 Ga0466708_046779_6207_7196 329
221 3300042590 Ga0466690_269579 Ga0466690_269579_282_1304 340
222 3300042590 Ga0466690_329801 Ga0466690_329801_497_1531 344

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01882 DUF58 Protein of unknown function DUF58 86 170 0.97
PF13519 VWA_2 von Willebrand factor type A domain 128 232 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.