Protein Family IF04560

Metagenome Isolate
121 Members
59 Samples
97 Scaffolds
255.17 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_302796|Ga0466690_302796_2363_3283
Length
306 aa
Sequence
MPYLFSLSYLFIHGYQGSKNNLLFNESGAYPLFIFIKYTFCDYLCPRNITKEHVLNRYFIYLAYNGKNYNGWQVQPNGVTVQATVEGALATLLRSPVPVVGAGRTDTGVHARRMVAHFDWHEPLTPLSFLTEKLNRILPRDIAIDKIVPVKEDAHARFDALSRTYTYYITTKKDPFTCEFAYKLHGVLDVDVMNKACEILYGYIDFTSFSKLHTDVKTNHCRISHARWEQEGDAWRFSITADRFLRNMVRAIVGTLIETGRGKLSLHGFSAIIEAKDRGRAGMSVPGHALFLTDIAYPGELFTINE

📊 Sample Types

Isolate 19.8%
Metagenome 80.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 34.5%
Termitidae 19.0%
Kalotermitidae 19.0%
Unclassified 8.6%
Rhinotermitidae 6.9%
Termopsidae 5.2%
Passalidae 3.4%
Hydrophilidae 1.7%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
2 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
3 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
4 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
5 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
6 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
10 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
15 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
16 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
17 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
18 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
19 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
22 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
23 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
24 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
25 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
26 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
27 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
28 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
29 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
30 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
31 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
32 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
33 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
42 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
43 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
44 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
45 3004667792 Bacteroides sp. 519 Isolate Blattidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
49 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
50 2923982719 Parabacteroides sp. 52 Isolate Blattidae
51 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
52 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
53 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
54 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
55 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
56 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
57 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
58 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
59 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_107968 3300042659 Bacteria 1476
2 Ga0466715_027200 3300042616 Bacteria 40765
3 Ga0466713_076593 3300042602 Bacteria 3573
4 Ga0466716_175724 3300042605 Bacteria 9919
5 Ga0466719_329398 3300042606 Bacteria 7268
6 Ga0466690_081733 3300042590 Bacteria 11404
7 Ga0466704_074072 3300042643 Bacteria 1778
8 Ga0466727_306236 3300042655 Bacteria 1179
9 Ga0466733_166181 3300042659 Bacteria 14983
10 Ga0466715_075610 3300042616 Bacteria 14367
11 Ga0466715_369648 3300042616 Bacteria 30222
12 Ga0466729_167721 3300042621 Unclassified 18026
13 Ga0466713_102098 3300042602 Bacteria 100663
14 Ga0466713_132210 3300042602 Bacteria 46954
15 Ga0466722_009058 3300042609 Bacteria 56021
16 Ga0068305_10763824 3300005083 Bacteria 3086
17 Ga0466735_000318 3300042624 Bacteria 2235
18 Ga0466735_032025 3300042624 Bacteria 2346
19 Ga0466735_034885 3300042624 Bacteria 1732
20 Ga0466735_126436 3300042624 Bacteria 2233
21 Ga0466704_173801 3300042643 Bacteria 4453
22 Ga0466710_157055 3300042613 Bacteria 14516
23 Ga0466715_029087 3300042616 Bacteria 29670
24 Ga0466715_508851 3300042616 Bacteria 15257
25 Ga0466707_043559 3300042601 Bacteria 24774
26 Ga0466722_013414 3300042609 Bacteria 34349
27 Ga0265387_1002205 3300024582 Bacteria 2764
28 Ga0466690_302796 3300042590 Bacteria 11233
29 Ga0466735_181660 3300042624 Bacteria 2596
30 Ga0466730_085458 3300042625 Bacteria 2268
31 Ga0466703_108796 3300042636 Bacteria 11244
32 Ga0466703_200544 3300042636 Bacteria 7899
33 Ga0466704_079962 3300042643 Bacteria 2885
34 Ga0466704_115231 3300042643 Bacteria 29648
35 Ga0466704_139219 3300042643 Bacteria 3587
36 Ga0466709_047096 3300042648 Bacteria 173163
37 Ga0466709_120883 3300042648 Bacteria 9734
38 Ga0466733_220888 3300042659 Bacteria 25948
39 Ga0466711_355417 3300042615 Bacteria 2712
40 Ga0466728_123149 3300042620 Bacteria 5205
41 Ga0466713_051127 3300042602 Bacteria 13157
42 Ga0466713_130991 3300042602 Bacteria 214088
43 Ga0466716_285550 3300042605 Bacteria 6821
44 Ga0123354_10223805 3300010882 Bacteria 1990
45 Ga0466657_046064 3300042582 Bacteria 11034
46 IMNBL1DRAFT_c0004641 3300000062 Bacteria 8159
47 Ga0466735_104468 3300042624 Bacteria 1180
48 Ga0466711_039341 3300042615 Bacteria 6951
49 Ga0466729_112858 3300042621 Bacteria 4505
50 Ga0466706_090349 3300042599 Bacteria 1255
51 Ga0466707_007028 3300042601 Bacteria 10664
52 Ga0466717_313791 3300042604 Bacteria 1478
53 Ga0466722_252821 3300042609 Bacteria 235840
54 Ga0466692_161407 3300042591 Bacteria 42971
55 Ga0466696_122411 3300042596 Bacteria 19339
56 Ga0466701_012719 3300042598 Bacteria 19345
57 Ga0466705_173999 3300042612 Bacteria 9692
58 Ga0466703_320358 3300042636 Bacteria 44545
59 Ga0466704_169199 3300042643 Bacteria 10314
60 Ga0466709_139699 3300042648 Bacteria 2049
61 Ga0466707_417823 3300042601 Bacteria 1589
62 Ga0466714_139060 3300042603 Bacteria 50968
63 Ga0466719_453528 3300042606 Bacteria 4007
64 Ga0466697_056567 3300042611 Bacteria 485126
65 Ga0123356_10761736 3300010049 Bacteria 1138
66 2227544066 2225789004 Bacteria 15495
67 IMNBL1DRAFT_c0001683 3300000062 Bacteria 16323
68 IMNBL1DRAFT_c0033391 3300000062 Bacteria 1843
69 Ga0466705_034832 3300042612 Bacteria 3284
70 Ga0466703_386985 3300042636 Bacteria 3284
71 Ga0466711_092577 3300042615 Bacteria 8561
72 Ga0466711_223836 3300042615 Bacteria 37949
73 Ga0466729_117018 3300042621 Bacteria 4379
74 Ga0466713_016019 3300042602 Bacteria 439221
75 Ga0466713_017440 3300042602 Bacteria 108493
76 Ga0466713_062719 3300042602 Bacteria 59430
77 Ga0466713_119741 3300042602 Bacteria 23414
78 Ga0466696_319882 3300042596 Bacteria 5979
79 Ga0068302_10200652 3300005071 Bacteria 5068
80 Ga0466705_288537 3300042612 Bacteria 5794
81 Ga0466729_231410 3300042621 Unclassified 2579
82 Ga0466703_036422 3300042636 Bacteria 6655
83 Ga0466704_230836 3300042643 Bacteria 1813
84 Ga0466704_245229 3300042643 Unclassified 1127
85 Ga0466704_295684 3300042643 Bacteria 12004
86 Ga0466710_130038 3300042613 Unclassified 4971
87 Ga0466715_063709 3300042616 Bacteria 13117
88 Ga0466715_470230 3300042616 Bacteria 12101
89 Ga0466706_143561 3300042599 Bacteria 5184
90 Ga0466706_287334 3300042599 Bacteria 2690
91 Ga0466690_055606 3300042590 Bacteria 6936
92 Ga0466690_254463 3300042590 Bacteria 5966
93 Ga0466692_109685 3300042591 Bacteria 126606
94 Ga0466693_066346 3300042592 Bacteria 1415
95 Ga0466696_020375 3300042596 Bacteria 1639
96 Ga0466705_252608 3300042612 Bacteria 2015
97 Ga0466704_373926 3300042643 Bacteria 2508

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_036422 Ga0466703_036422_680_1393 237
2 3300042609 Ga0466722_252821 Ga0466722_252821_231431_232168 245
3 3300042613 Ga0466710_157055 Ga0466710_157055_11118_11855 245
4 3300010882 Ga0123354_10223805 Ga0123354_102238052 246
5 3300042603 Ga0466714_139060 Ga0466714_139060_18097_18840 247
6 3300042582 Ga0466657_046064 Ga0466657_046064_9723_10469 248
7 3300042602 Ga0466713_076593 Ga0466713_076593_1627_2373 248
8 3300042611 Ga0466697_056567 Ga0466697_056567_239507_240253 248
9 3300042613 Ga0466710_130038 Ga0466710_130038_3078_3824 248
10 3300042615 Ga0466711_039341 Ga0466711_039341_1278_2024 248
11 iso_pr_bacteria 2940202316 2940204634 248
12 3300000062 IMNBL1DRAFT_c0004641 IMNBL1DRAFT_00046415 249
13 3300042591 Ga0466692_109685 Ga0466692_109685_50862_51611 249
14 3300042599 Ga0466706_090349 Ga0466706_090349_194_943 249
15 3300042599 Ga0466706_143561 Ga0466706_143561_1479_2228 249
16 3300042601 Ga0466707_007028 Ga0466707_007028_1608_2357 249
17 3300042601 Ga0466707_043559 Ga0466707_043559_21980_22729 249
18 3300042602 Ga0466713_016019 Ga0466713_016019_65000_65749 249
19 3300042602 Ga0466713_132210 Ga0466713_132210_12352_13101 249
20 3300042621 Ga0466729_167721 Ga0466729_167721_1506_2255 249
21 3300042624 Ga0466735_000318 Ga0466735_000318_1000_1749 249
22 3300042625 Ga0466730_085458 Ga0466730_085458_1031_1780 249
23 3300042636 Ga0466703_108796 Ga0466703_108796_3824_4573 249
24 3300042636 Ga0466703_386985 Ga0466703_386985_1715_2464 249
25 3300042643 Ga0466704_079962 Ga0466704_079962_1267_2016 249
26 3300042643 Ga0466704_139219 Ga0466704_139219_1005_1754 249
27 3300042659 Ga0466733_220888 Ga0466733_220888_4021_4770 249
28 iso_pr_bacteria 2695420314 2695473275 249
29 iso_pr_bacteria 2873600114 2873602093 249
30 iso_pr_bacteria 2910959314 2910961854 249
31 iso_pr_bacteria 643348524 643422794 249
32 3300000062 IMNBL1DRAFT_c0033391 IMNBL1DRAFT_00333912 250
33 3300005083 Ga0068305_10763824 Ga0068305_107638243 250
34 3300042596 Ga0466696_020375 Ga0466696_020375_366_1118 250
35 3300042596 Ga0466696_122411 Ga0466696_122411_9347_10099 250
36 3300042602 Ga0466713_017440 Ga0466713_017440_52020_52772 250
37 3300042602 Ga0466713_130991 Ga0466713_130991_21535_22287 250
38 3300042609 Ga0466722_009058 Ga0466722_009058_22839_23591 250
39 3300042612 Ga0466705_288537 Ga0466705_288537_3804_4556 250
40 3300042616 Ga0466715_470230 Ga0466715_470230_5040_5792 250
41 3300042643 Ga0466704_169199 Ga0466704_169199_1249_2001 250
42 3300042659 Ga0466733_107968 Ga0466733_107968_706_1458 250
43 3300042659 Ga0466733_166181 Ga0466733_166181_2801_3553 250
44 iso_pr_bacteria 2910942425 2910943190 250
45 iso_pr_bacteria 3004667792 3004671755 250
46 3300024582 Ga0265387_1002205 Ga0265387_10022052 251
47 3300042590 Ga0466690_055606 Ga0466690_055606_1001_1756 251
48 3300042615 Ga0466711_223836 Ga0466711_223836_20968_21723 251
49 3300042616 Ga0466715_075610 Ga0466715_075610_2123_2878 251
50 iso_pr_bacteria 2910926975 2910927367 251
51 2225789004 2227544066 2228068006 252
52 3300010049 Ga0123356_10761736 Ga0123356_107617361 252
53 3300042591 Ga0466692_161407 Ga0466692_161407_20696_21454 252
54 3300042602 Ga0466713_051127 Ga0466713_051127_10810_11568 252
55 3300042602 Ga0466713_062719 Ga0466713_062719_16013_16771 252
56 3300042606 Ga0466719_453528 Ga0466719_453528_1298_2056 252
57 3300042612 Ga0466705_034832 Ga0466705_034832_2437_3195 252
58 3300042612 Ga0466705_173999 Ga0466705_173999_6393_7151 252
59 3300042615 Ga0466711_355417 Ga0466711_355417_1644_2402 252
60 3300042621 Ga0466729_112858 Ga0466729_112858_1108_1866 252
61 3300042621 Ga0466729_117018 Ga0466729_117018_2421_3179 252
62 3300042636 Ga0466703_320358 Ga0466703_320358_6150_6908 252
63 3300042643 Ga0466704_173801 Ga0466704_173801_2792_3550 252
64 iso_pr_bacteria 2910930387 2910931275 252
65 3300000062 IMNBL1DRAFT_c0001683 IMNBL1DRAFT_00016835 253
66 3300042602 Ga0466713_102098 Ga0466713_102098_56249_57010 253
67 3300042604 Ga0466717_313791 Ga0466717_313791_696_1457 253
68 3300042615 Ga0466711_092577 Ga0466711_092577_4381_5142 253
69 3300042621 Ga0466729_231410 Ga0466729_231410_805_1566 253
70 3300042624 Ga0466735_034885 Ga0466735_034885_722_1483 253
71 3300042648 Ga0466709_047096 Ga0466709_047096_102157_102918 253
72 iso_pr_bacteria 2940205530 2940207873 253
73 iso_pr_bacteria 2940212447 2940214788 253
74 iso_pr_bacteria 2940298504 2940300687 253
75 iso_pr_bacteria 2940302308 2940304490 253
76 iso_pr_bacteria 2940306115 2940308208 253
77 iso_pr_bacteria 2940309933 2940311893 253
78 iso_pr_bacteria 2940313741 2940315860 253
79 iso_pr_bacteria 2940317558 2940319521 253
80 iso_pr_bacteria 2940321370 2940323126 253
81 iso_pr_bacteria 2940325180 2940327361 253
82 iso_pr_bacteria 2940328985 2940331321 253
83 iso_pr_bacteria 2940332795 2940334912 253
84 3300042601 Ga0466707_417823 Ga0466707_417823_759_1523 254
85 3300042602 Ga0466713_119741 Ga0466713_119741_22539_23303 254
86 3300042616 Ga0466715_508851 Ga0466715_508851_9772_10536 254
87 3300042636 Ga0466703_200544 Ga0466703_200544_2671_3435 254
88 iso_pr_bacteria 8100166142 8100167316 254
89 3300042592 Ga0466693_066346 Ga0466693_066346_314_1081 255
90 3300042643 Ga0466704_074072 Ga0466704_074072_203_970 255
91 3300042643 Ga0466704_245229 Ga0466704_245229_253_1020 255
92 iso_pr_bacteria 2923982719 2923982762 255
93 iso_pr_bacteria 2940371297 2940372834 255
94 3300042590 Ga0466690_254463 Ga0466690_254463_1113_1883 256
95 3300042648 Ga0466709_120883 Ga0466709_120883_7935_8705 256
96 3300042590 Ga0466690_081733 Ga0466690_081733_7305_8078 257
97 3300042605 Ga0466716_175724 Ga0466716_175724_2224_2997 257
98 3300042606 Ga0466719_329398 Ga0466719_329398_5246_6019 257
99 3300042616 Ga0466715_063709 Ga0466715_063709_11420_12193 257
100 3300042655 Ga0466727_306236 Ga0466727_306236_114_887 257
101 3300042605 Ga0466716_285550 Ga0466716_285550_5072_5848 258
102 3300042624 Ga0466735_104468 Ga0466735_104468_362_1138 258
103 3300042598 Ga0466701_012719 Ga0466701_012719_7214_8011 259
104 3300042616 Ga0466715_027200 Ga0466715_027200_6993_7775 260
105 3300042624 Ga0466735_181660 Ga0466735_181660_828_1613 261
106 3300042599 Ga0466706_287334 Ga0466706_287334_1829_2617 262
107 3300042609 Ga0466722_013414 Ga0466722_013414_11731_12519 262
108 3300042624 Ga0466735_126436 Ga0466735_126436_591_1379 262
109 3300042648 Ga0466709_139699 Ga0466709_139699_482_1270 262
110 3300042596 Ga0466696_319882 Ga0466696_319882_4712_5503 263
111 3300005071 Ga0068302_10200652 Ga0068302_102006523 264
112 3300042612 Ga0466705_252608 Ga0466705_252608_600_1397 265
113 3300042616 Ga0466715_369648 Ga0466715_369648_23962_24771 269
114 3300042624 Ga0466735_032025 Ga0466735_032025_497_1306 269
115 3300042616 Ga0466715_029087 Ga0466715_029087_26002_26850 282
116 3300042643 Ga0466704_115231 Ga0466704_115231_22980_23828 282
117 3300042620 Ga0466728_123149 Ga0466728_123149_3406_4317 303
118 3300042643 Ga0466704_230836 Ga0466704_230836_694_1605 303
119 3300042643 Ga0466704_295684 Ga0466704_295684_4472_5383 303
120 3300042643 Ga0466704_373926 Ga0466704_373926_1389_2300 303
121 3300042590 Ga0466690_302796 Ga0466690_302796_2363_3283 306

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01416 PseudoU_synth_1 tRNA pseudouridine synthase 196 298 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.