Protein Family IF04533

Metagenome Metatranscriptome Isolate
145 Members
42 Samples
137 Scaffolds
375.37 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_216101|Ga0466690_216101_219_1394
Length
386 aa
Sequence
VFIYIPFNKEHSMSINKVKTAVVGCGTISDIYLKNMTGAFEILDVVGCCDIIPERMAKRAGQYNIKQMKIEEILNNPDLELVLNITDPVNHHLVSSQVLNAGKHLYSEKPIDLSIEAARELVQLADQKKLLYGNAPDTFLGQAIQTARFYLDAGVIGDVTSVYATLNRDELYPFTALPGGGIGLDVGVYYITAILSILGPVKEVSGFVDTLRAERTHYFPNKDDFGQKFVLQAENRVVGSFRFANGVMGSLMFNSCSIGNEKPQIVMFGTEGILYMPDPNQFGGEVKVILKGQTEPITLAPTHGFTENSRGIGPAELAWSLRRGRKPRTSKEMAFHGLELLLGLYKSCETKQFYQMTSSFERPPAVPRGYLGEGYGGSPAEAGIAV

📊 Sample Types

Isolate 4.8%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 34.1%
Termitidae 31.7%
Unclassified 14.6%
Rhinotermitidae 7.3%
Termopsidae 7.3%
Hodotermitidae 2.4%
Blaberidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 22

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2772190975 Treponema sp. RmG30 Isolate Blaberidae
13 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_018294 3300042614 Unclassified 19252
2 Ga0466712_055102 3300042614 Bacteria 7330
3 Ga0466723_103387 3300042618 Unclassified 1950
4 Ga0466719_064782 3300042606 Bacteria 13923
5 Ga0466719_469388 3300042606 Bacteria 20806
6 Ga0466722_070485 3300042609 Bacteria 12999
7 Ga0466722_159471 3300042609 Bacteria 1655
8 Ga0466722_267967 3300042609 Bacteria 1947
9 Ga0123353_10083877 3300010167 Bacteria 5129
10 Ga0466690_059153 3300042590 Unclassified 1544
11 Ga0466692_094597 3300042591 Bacteria 2461
12 Ga0466692_185134 3300042591 Bacteria 6483
13 Ga0466691_025735 3300042593 Bacteria 7688
14 Ga0466696_341581 3300042596 Bacteria 4691
15 Ga0466704_210106 3300042643 Bacteria 10055
16 Ga0466709_127489 3300042648 Bacteria 16562
17 Ga0466708_088013 3300042652 Bacteria 8738
18 JGI24698J34947_10035693 3300002449 Bacteria 2593
19 Ga0466705_098563 3300042612 Bacteria 5944
20 Ga0466705_342791 3300042612 Bacteria 3550
21 Ga0466705_357343 3300042612 Bacteria 1558
22 Ga0466733_078348 3300042659 Bacteria 4434
23 Ga0466712_195764 3300042614 Bacteria 9065
24 Ga0466711_012004 3300042615 Bacteria 25076
25 Ga0466711_376418 3300042615 Bacteria 6825
26 Ga0466723_093729 3300042618 Bacteria 11545
27 Ga0466707_108624 3300042601 Bacteria 1246
28 Ga0466722_064990 3300042609 Bacteria 9267
29 Ga0123353_10060818 3300010167 Bacteria 6056
30 Ga0466696_241330 3300042596 Unclassified 1499
31 Ga0466704_584008 3300042643 Unclassified 1760
32 Ga0466704_589616 3300042643 Unclassified 4605
33 Ga0466709_366458 3300042648 Bacteria 1747
34 Ga0466708_342285 3300042652 Bacteria 16446
35 Ga0466727_153191 3300042655 Unclassified 1314
36 JGI24698J34947_10004549 3300002449 Unclassified 7556
37 JGI24702J35022_10064094 3300002462 Bacteria 1970
38 Ga0466712_023288 3300042614 Unclassified 12251
39 Ga0466712_197350 3300042614 Bacteria 26294
40 Ga0466711_064831 3300042615 Bacteria 3056
41 Ga0466711_197226 3300042615 Bacteria 15378
42 Ga0466723_202076 3300042618 Bacteria 15793
43 Ga0466726_287435 3300042619 Bacteria 2259
44 Ga0466716_069357 3300042605 Bacteria 12001
45 Ga0123357_10042207 3300009784 Bacteria 6203
46 Ga0123354_10290436 3300010882 Bacteria 1568
47 Ga0466690_029057 3300042590 Unclassified 1648
48 Ga0466690_134643 3300042590 Bacteria 6180
49 Ga0466691_033964 3300042593 Bacteria 5542
50 Ga0466696_019198 3300042596 Unclassified 3724
51 Ga0466696_063061 3300042596 Bacteria 1312
52 Ga0466703_231978 3300042636 Bacteria 6909
53 Ga0466704_099676 3300042643 Bacteria 8238
54 Ga0466727_284785 3300042655 Bacteria 1168
55 Ga0466705_193055 3300042612 Bacteria 6489
56 Ga0466705_203005 3300042612 Bacteria 6934
57 Ga0466711_204018 3300042615 Bacteria 2742
58 Ga0466711_471676 3300042615 Bacteria 5925
59 Ga0466723_258566 3300042618 Bacteria 3640
60 Ga0466728_013908 3300042620 Bacteria 19460
61 Ga0466707_141592 3300042601 Bacteria 3638
62 Ga0466716_426572 3300042605 Bacteria 4772
63 Ga0123357_10078472 3300009784 Bacteria 4351
64 Ga0223677_1018565 3300021239 Bacteria 1277
65 Ga0466696_112649 3300042596 Bacteria 4998
66 Ga0466699_225841 3300042597 Bacteria 9280
67 Ga0466699_311069 3300042597 Bacteria 4923
68 Ga0466703_070922 3300042636 Bacteria 6833
69 Ga0466703_235899 3300042636 Bacteria 23764
70 Ga0466704_114214 3300042643 Bacteria 6163
71 Ga0466708_158552 3300042652 Bacteria 10346
72 Ga0466727_241961 3300042655 Bacteria 2595
73 Ga0466705_210356 3300042612 Unclassified 6827
74 Ga0466711_065095 3300042615 Bacteria 13279
75 Ga0466715_040033 3300042616 Bacteria 5285
76 Ga0466715_137897 3300042616 Bacteria 2418
77 Ga0466715_302459 3300042616 Unclassified 9013
78 Ga0466726_263004 3300042619 Bacteria 1871
79 Ga0466726_285600 3300042619 Unclassified 1155
80 Ga0466706_111462 3300042599 Bacteria 4495
81 Ga0466716_057424 3300042605 Unclassified 4094
82 Ga0466716_131249 3300042605 Bacteria 11314
83 Ga0466716_327237 3300042605 Unclassified 3860
84 Ga0466722_134119 3300042609 Bacteria 1491
85 Ga0123357_10045241 3300009784 Bacteria 5972
86 Ga0466690_216101 3300042590 Bacteria 2853
87 Ga0466690_271286 3300042590 Unclassified 2175
88 Ga0466690_279870 3300042590 Bacteria 2136
89 Ga0466692_088411 3300042591 Bacteria 10167
90 Ga0466694_029496 3300042594 Bacteria 2202
91 Ga0466694_107642 3300042594 Bacteria 9369
92 Ga0466699_256893 3300042597 Bacteria 1991
93 Ga0466703_013993 3300042636 Bacteria 19436
94 Ga0466703_154307 3300042636 Unclassified 4358
95 Ga0466704_241045 3300042643 Bacteria 4892
96 Ga0466704_339320 3300042643 Bacteria 14735
97 Ga0123357_10000294 3300009784 Bacteria 47833
98 Ga0466733_070077 3300042659 Bacteria 1408
99 Ga0466711_292537 3300042615 Bacteria 2327
100 Ga0466726_452581 3300042619 Bacteria 3050
101 Ga0466719_121190 3300042606 Unclassified 2417
102 Ga0466719_177023 3300042606 Bacteria 5282
103 Ga0123353_10112391 3300010167 Bacteria 4386
104 Ga0456237_0000262 3300041968 Bacteria 7736
105 Ga0466692_181579 3300042591 Bacteria 2473
106 Ga0466699_119942 3300042597 Bacteria 9955
107 Ga0466704_036310 3300042643 Bacteria 6099
108 Ga0466709_254255 3300042648 Bacteria 4622
109 JGI24698J34947_10002096 3300002449 Bacteria 10663
110 JGI24695J34938_10001877 3300002450 Bacteria 17078
111 Ga0466712_078139 3300042614 Bacteria 11617
112 Ga0466712_089040 3300042614 Bacteria 4550
113 Ga0466718_044414 3300042617 Bacteria 6973
114 Ga0466716_179148 3300042605 Bacteria 6158
115 Ga0466719_355368 3300042606 Unclassified 3850
116 Ga0466720_079491 3300042607 Bacteria 1684
117 Ga0466691_029500 3300042593 Bacteria 7308
118 Ga0466699_146176 3300042597 Bacteria 1172
119 Ga0466709_180071 3300042648 Bacteria 7510
120 JGI24698J34947_10005329 3300002449 Bacteria 7056
121 JGI24698J34947_10050925 3300002449 Bacteria 2086
122 Ga0466705_008895 3300042612 Bacteria 6848
123 Ga0466715_052358 3300042616 Bacteria 13944
124 Ga0466726_475314 3300042619 Bacteria 2378
125 Ga0466719_157218 3300042606 Bacteria 10312
126 Ga0123357_10052198 3300009784 Bacteria 5522
127 Ga0466690_031602 3300042590 Bacteria 1646
128 Ga0466694_309406 3300042594 Bacteria 10427
129 Ga0466699_093955 3300042597 Bacteria 1503
130 Ga0466699_323936 3300042597 Unclassified 1261
131 Ga0466735_116719 3300042624 Bacteria 7734
132 Ga0466702_339009 3300042635 Bacteria 8822
133 Ga0466703_061536 3300042636 Bacteria 11698
134 Ga0466708_242265 3300042652 Bacteria 10690
135 Ga0466708_319821 3300042652 Bacteria 5307
136 Ga0466727_305901 3300042655 Bacteria 10053
137 JGI24698J34947_10006576 3300002449 Unclassified 6384

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_146176 Ga0466699_146176_135_1109 324
2 3300042619 Ga0466726_285600 Ga0466726_285600_108_1133 329
3 3300021239 Ga0223677_1018565 Ga0223677_10185652 333
4 3300042590 Ga0466690_031602 Ga0466690_031602_599_1606 335
5 3300042655 Ga0466727_284785 Ga0466727_284785_43_1152 355
6 3300042601 Ga0466707_141592 Ga0466707_141592_2554_3624 356
7 3300042590 Ga0466690_279870 Ga0466690_279870_585_1724 361
8 3300042605 Ga0466716_327237 Ga0466716_327237_2080_3219 361
9 3300042652 Ga0466708_088013 Ga0466708_088013_7396_8535 361
10 3300042652 Ga0466708_342285 Ga0466708_342285_3310_4449 361
11 3300042614 Ga0466712_078139 Ga0466712_078139_6720_7862 362
12 3300042652 Ga0466708_158552 Ga0466708_158552_1130_2269 362
13 3300042652 Ga0466708_319821 Ga0466708_319821_2738_3877 362
14 3300042615 Ga0466711_197226 Ga0466711_197226_14009_15100 363
15 3300042590 Ga0466690_271286 Ga0466690_271286_1004_2143 364
16 3300042606 Ga0466719_177023 Ga0466719_177023_3504_4643 364
17 3300042614 Ga0466712_018294 Ga0466712_018294_10875_12017 364
18 3300042597 Ga0466699_093955 Ga0466699_093955_40_1137 365
19 3300002449 JGI24698J34947_10004549 JGI24698J34947_100045496 367
20 3300042594 Ga0466694_029496 Ga0466694_029496_308_1447 367
21 3300002449 JGI24698J34947_10050925 JGI24698J34947_100509252 368
22 3300042591 Ga0466692_094597 Ga0466692_094597_516_1646 369
23 3300042614 Ga0466712_023288 Ga0466712_023288_8563_9705 369
24 3300042614 Ga0466712_195764 Ga0466712_195764_238_1380 369
25 3300042659 Ga0466733_078348 Ga0466733_078348_474_1583 369
26 3300002449 JGI24698J34947_10005329 JGI24698J34947_100053294 370
27 3300002449 JGI24698J34947_10035693 JGI24698J34947_100356932 370
28 3300042605 Ga0466716_057424 Ga0466716_057424_333_1472 370
29 3300042614 Ga0466712_089040 Ga0466712_089040_3140_4282 370
30 3300042605 Ga0466716_426572 Ga0466716_426572_3272_4411 371
31 3300042618 Ga0466723_202076 Ga0466723_202076_4972_6111 372
32 3300042612 Ga0466705_008895 Ga0466705_008895_5309_6433 374
33 3300042615 Ga0466711_012004 Ga0466711_012004_4802_5926 374
34 3300042636 Ga0466703_061536 Ga0466703_061536_10092_11231 374
35 3300042648 Ga0466709_254255 Ga0466709_254255_1074_2213 374
36 3300042591 Ga0466692_181579 Ga0466692_181579_889_2019 376
37 3300042615 Ga0466711_376418 Ga0466711_376418_5255_6385 376
38 3300042619 Ga0466726_452581 Ga0466726_452581_113_1243 376
39 3300042619 Ga0466726_475314 Ga0466726_475314_860_1990 376
40 3300042636 Ga0466703_231978 Ga0466703_231978_2463_3593 376
41 3300042593 Ga0466691_033964 Ga0466691_033964_2340_3473 377
42 3300042615 Ga0466711_292537 Ga0466711_292537_798_1931 377
43 iso_pr_bacteria 2781125666 2781343837 377
44 iso_pr_bacteria 2781125666 2781343840 377
45 3300009784 Ga0123357_10000294 Ga0123357_100002941 378
46 3300009784 Ga0123357_10000294 Ga0123357_100002944 378
47 3300010167 Ga0123353_10112391 Ga0123353_101123912 378
48 3300042590 Ga0466690_059153 Ga0466690_059153_110_1249 379
49 3300042590 Ga0466690_134643 Ga0466690_134643_1079_2218 379
50 3300042593 Ga0466691_025735 Ga0466691_025735_2024_3163 379
51 3300042596 Ga0466696_019198 Ga0466696_019198_612_1751 379
52 3300042596 Ga0466696_063061 Ga0466696_063061_38_1177 379
53 3300042596 Ga0466696_112649 Ga0466696_112649_2093_3232 379
54 3300042596 Ga0466696_241330 Ga0466696_241330_339_1478 379
55 3300042596 Ga0466696_341581 Ga0466696_341581_207_1346 379
56 3300042605 Ga0466716_131249 Ga0466716_131249_1203_2342 379
57 3300042606 Ga0466719_064782 Ga0466719_064782_1750_2889 379
58 3300042606 Ga0466719_121190 Ga0466719_121190_251_1390 379
59 3300042606 Ga0466719_157218 Ga0466719_157218_5453_6592 379
60 3300042606 Ga0466719_355368 Ga0466719_355368_2292_3431 379
61 3300042607 Ga0466720_079491 Ga0466720_079491_295_1434 379
62 3300042609 Ga0466722_159471 Ga0466722_159471_305_1444 379
63 3300042612 Ga0466705_193055 Ga0466705_193055_4699_5838 379
64 3300042612 Ga0466705_210356 Ga0466705_210356_1118_2257 379
65 3300042612 Ga0466705_342791 Ga0466705_342791_258_1397 379
66 3300042615 Ga0466711_065095 Ga0466711_065095_5275_6414 379
67 3300042615 Ga0466711_204018 Ga0466711_204018_1408_2547 379
68 3300042616 Ga0466715_040033 Ga0466715_040033_1025_2164 379
69 3300042616 Ga0466715_302459 Ga0466715_302459_4311_5450 379
70 3300042618 Ga0466723_093729 Ga0466723_093729_5744_6883 379
71 3300042618 Ga0466723_103387 Ga0466723_103387_207_1346 379
72 3300042619 Ga0466726_263004 Ga0466726_263004_158_1297 379
73 3300042619 Ga0466726_287435 Ga0466726_287435_88_1227 379
74 3300042636 Ga0466703_154307 Ga0466703_154307_1791_2930 379
75 3300042643 Ga0466704_036310 Ga0466704_036310_3028_4167 379
76 3300042643 Ga0466704_099676 Ga0466704_099676_69_1208 379
77 3300042643 Ga0466704_114214 Ga0466704_114214_108_1247 379
78 3300042643 Ga0466704_589616 Ga0466704_589616_1872_3011 379
79 3300042652 Ga0466708_242265 Ga0466708_242265_5115_6254 379
80 3300042655 Ga0466727_153191 Ga0466727_153191_47_1186 379
81 3300042655 Ga0466727_241961 Ga0466727_241961_11_1150 379
82 3300042655 Ga0466727_305901 Ga0466727_305901_3230_4369 379
83 iso_pr_bacteria 650716099 650879976 379
84 3300002450 JGI24695J34938_10001877 JGI24695J34938_100018774 380
85 3300041968 Ga0456237_0000262 Ga0456237_0000262_1499_2641 380
86 3300042590 Ga0466690_029057 Ga0466690_029057_304_1446 380
87 3300042591 Ga0466692_088411 Ga0466692_088411_6557_7699 380
88 3300042591 Ga0466692_185134 Ga0466692_185134_3346_4488 380
89 3300042594 Ga0466694_107642 Ga0466694_107642_5511_6653 380
90 3300042594 Ga0466694_309406 Ga0466694_309406_6083_7225 380
91 3300042597 Ga0466699_119942 Ga0466699_119942_2810_3952 380
92 3300042597 Ga0466699_225841 Ga0466699_225841_3730_4872 380
93 3300042597 Ga0466699_256893 Ga0466699_256893_106_1248 380
94 3300042597 Ga0466699_311069 Ga0466699_311069_379_1521 380
95 3300042597 Ga0466699_323936 Ga0466699_323936_74_1216 380
96 3300042599 Ga0466706_111462 Ga0466706_111462_259_1401 380
97 3300042605 Ga0466716_069357 Ga0466716_069357_2417_3559 380
98 3300042605 Ga0466716_179148 Ga0466716_179148_4485_5627 380
99 3300042606 Ga0466719_469388 Ga0466719_469388_7279_8421 380
100 3300042609 Ga0466722_070485 Ga0466722_070485_10538_11680 380
101 3300042609 Ga0466722_134119 Ga0466722_134119_125_1267 380
102 3300042612 Ga0466705_098563 Ga0466705_098563_2001_3143 380
103 3300042612 Ga0466705_203005 Ga0466705_203005_1381_2523 380
104 3300042612 Ga0466705_357343 Ga0466705_357343_283_1425 380
105 3300042614 Ga0466712_055102 Ga0466712_055102_2696_3838 380
106 3300042615 Ga0466711_064831 Ga0466711_064831_450_1592 380
107 3300042615 Ga0466711_471676 Ga0466711_471676_898_2040 380
108 3300042616 Ga0466715_052358 Ga0466715_052358_12328_13470 380
109 3300042616 Ga0466715_137897 Ga0466715_137897_38_1180 380
110 3300042617 Ga0466718_044414 Ga0466718_044414_1088_2230 380
111 3300042618 Ga0466723_258566 Ga0466723_258566_2383_3525 380
112 3300042620 Ga0466728_013908 Ga0466728_013908_18071_19213 380
113 3300042624 Ga0466735_116719 Ga0466735_116719_578_1720 380
114 3300042635 Ga0466702_339009 Ga0466702_339009_7613_8755 380
115 3300042636 Ga0466703_013993 Ga0466703_013993_8493_9635 380
116 3300042636 Ga0466703_070922 Ga0466703_070922_4040_5182 380
117 3300042636 Ga0466703_235899 Ga0466703_235899_21839_22981 380
118 3300042643 Ga0466704_210106 Ga0466704_210106_7977_9119 380
119 3300042643 Ga0466704_241045 Ga0466704_241045_401_1543 380
120 3300042643 Ga0466704_339320 Ga0466704_339320_7572_8714 380
121 3300042643 Ga0466704_584008 Ga0466704_584008_218_1360 380
122 3300042648 Ga0466709_127489 Ga0466709_127489_10113_11255 380
123 3300042648 Ga0466709_180071 Ga0466709_180071_5996_7138 380
124 3300042648 Ga0466709_366458 Ga0466709_366458_169_1311 380
125 3300042659 Ga0466733_070077 Ga0466733_070077_90_1232 380
126 iso_pr_bacteria 2781125652 2781312504 380
127 iso_pr_bacteria 2781125690 2781428002 380
128 iso_pr_bacteria 2781125694 2781437409 380
129 3300002449 JGI24698J34947_10002096 JGI24698J34947_100020968 381
130 3300002449 JGI24698J34947_10006576 JGI24698J34947_100065762 381
131 3300002462 JGI24702J35022_10064094 JGI24702J35022_100640942 381
132 3300009784 Ga0123357_10042207 Ga0123357_100422071 381
133 3300009784 Ga0123357_10045241 Ga0123357_100452413 381
134 3300009784 Ga0123357_10052198 Ga0123357_100521984 381
135 3300009784 Ga0123357_10078472 Ga0123357_100784722 381
136 3300010167 Ga0123353_10060818 Ga0123353_100608182 381
137 3300010167 Ga0123353_10083877 Ga0123353_100838771 381
138 3300010882 Ga0123354_10290436 Ga0123354_102904362 381
139 3300042601 Ga0466707_108624 Ga0466707_108624_54_1199 381
140 3300042609 Ga0466722_064990 Ga0466722_064990_4286_5431 381
141 3300042609 Ga0466722_267967 Ga0466722_267967_524_1669 381
142 3300042614 Ga0466712_197350 Ga0466712_197350_13765_14910 381
143 iso_pr_bacteria 2772190975 2773723794 381
144 3300042593 Ga0466691_029500 Ga0466691_029500_882_2057 383
145 3300042590 Ga0466690_216101 Ga0466690_216101_219_1394 386

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22725 GFO_IDH_MocA_C3 GFO/IDH/MocA C-terminal domain 144 274 0.96
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 19 132 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01408 GO:0000166 nucleotide binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.