Protein Family IF04532
Metagenome
Isolate
125
Members
45
Samples
124
Scaffolds
500.54
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_213508|Ga0466690_213508_390_2099
- Length
- 544 aa
- Sequence
- MAYIRYVNNPSGAVYASLVDGERVGKSVKQKYLGSLGLVIDRENGIFKNYQYSIESGYSEIPSGSEHAGVGRPRKEKLILDFGDSFVLDKYLSTLPFYSAYQIVMPLHKDTLFSLLFYRILTDKKAYCYADSWWSGNYACILFPGAKLQSQRVSEFLVMLGDEEVQRKFFDEYLTTIYGKQGGTSGILIDSTGLTNMSKMSLTQLSHHNGEISMEIRLIYVIDRRNGMPIYFRYCPGNIVDVSTLCITLAELSQFNIAIDYAIVDAGYFSEGNVKELYKNNVHFVTRLAPNRTIYKQVTESELTDILSSKYAVRYGNRLVYLKKKEIDIYGYTGYAYIGVDMDSRNQQFKRTAFAAIEDKKSLEEMDERIAKLGVFILLSSDDMETSEILPLYYTRQQIEQIFDIGKNYADLLPLRVQSEDTFRGHLMLTFMATAILQMLQRDILSKRKKKDKTNPEGAFMYLRNQKCKVYGKNIIPQERVKNVNEIYKLLGIVCPTTIDSTNSPSSSRKWCGRQRKKQRRRDAVVFCGLYERQSGNYYRIHRP
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.5%
Kalotermitidae
30.2%
Unclassified
7.0%
Passalidae
4.7%
Termopsidae
4.7%
Taxonomy
Archaea
0
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 29 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_218468 | 3300042600 | Bacteria | 1895 |
| 2 | Ga0466717_185389 | 3300042604 | Bacteria | 2164 |
| 3 | Ga0466697_004161 | 3300042611 | Bacteria | 2593 |
| 4 | Ga0466697_037267 | 3300042611 | Unclassified | 3326 |
| 5 | JGI24695J34938_10050882 | 3300002450 | Bacteria | 1815 |
| 6 | Ga0466690_213508 | 3300042590 | Bacteria | 2785 |
| 7 | Ga0466690_337239 | 3300042590 | Unclassified | 3912 |
| 8 | Ga0466705_531539 | 3300042612 | Bacteria | 2348 |
| 9 | Ga0466715_283457 | 3300042616 | Bacteria | 2255 |
| 10 | Ga0466728_399182 | 3300042620 | Bacteria | 2150 |
| 11 | Ga0466697_169390 | 3300042611 | Bacteria | 2817 |
| 12 | Ga0466703_102686 | 3300042636 | Unclassified | 1947 |
| 13 | Ga0466727_302259 | 3300042655 | Unclassified | 1964 |
| 14 | Ga0466700_182489 | 3300042600 | Bacteria | 2171 |
| 15 | Ga0466707_421183 | 3300042601 | Bacteria | 3656 |
| 16 | Ga0466717_038805 | 3300042604 | Bacteria | 1817 |
| 17 | Ga0466719_064099 | 3300042606 | Bacteria | 4134 |
| 18 | Ga0466720_193364 | 3300042607 | Bacteria | 2384 |
| 19 | Ga0466721_393376 | 3300042608 | Bacteria | 2569 |
| 20 | Ga0123356_10085274 | 3300010049 | Bacteria | 2995 |
| 21 | Ga0123356_10144267 | 3300010049 | Bacteria | 2353 |
| 22 | JGI24702J35022_10077514 | 3300002462 | Unclassified | 1798 |
| 23 | JGI24705J35276_12223734 | 3300002504 | Bacteria | 2539 |
| 24 | Ga0068305_10083773 | 3300005083 | Unclassified | 1662 |
| 25 | Ga0264413_131440 | 3300024493 | Unclassified | 1944 |
| 26 | Ga0466690_161968 | 3300042590 | Unclassified | 2163 |
| 27 | Ga0466691_099858 | 3300042593 | Bacteria | 2243 |
| 28 | Ga0466694_050881 | 3300042594 | Bacteria | 1895 |
| 29 | Ga0466694_279765 | 3300042594 | Bacteria | 2795 |
| 30 | Ga0466694_374017 | 3300042594 | Bacteria | 2678 |
| 31 | Ga0466696_320534 | 3300042596 | Bacteria | 5197 |
| 32 | Ga0466696_330743 | 3300042596 | Bacteria | 2597 |
| 33 | Ga0466711_216845 | 3300042615 | Bacteria | 11004 |
| 34 | Ga0466723_012182 | 3300042618 | Bacteria | 1699 |
| 35 | Ga0466723_259195 | 3300042618 | Bacteria | 3762 |
| 36 | Ga0466705_218567 | 3300042612 | Bacteria | 2677 |
| 37 | Ga0466704_225187 | 3300042643 | Bacteria | 3917 |
| 38 | Ga0466701_080036 | 3300042598 | Unclassified | 1952 |
| 39 | Ga0466707_054930 | 3300042601 | Bacteria | 3295 |
| 40 | Ga0466716_370411 | 3300042605 | Unclassified | 1859 |
| 41 | Ga0466719_209934 | 3300042606 | Bacteria | 2202 |
| 42 | Ga0466719_267005 | 3300042606 | Bacteria | 3495 |
| 43 | Ga0466698_227828 | 3300042610 | Unclassified | 1810 |
| 44 | Ga0123357_10194189 | 3300009784 | Unclassified | 2330 |
| 45 | Ga0123356_10014436 | 3300010049 | Bacteria | 7595 |
| 46 | Ga0466691_135881 | 3300042593 | Bacteria | 2662 |
| 47 | Ga0466695_313675 | 3300042595 | Bacteria | 1872 |
| 48 | Ga0466699_094360 | 3300042597 | Unclassified | 1854 |
| 49 | Ga0466733_187567 | 3300042659 | Unclassified | 1881 |
| 50 | Ga0466710_090096 | 3300042613 | Bacteria | 1741 |
| 51 | Ga0466723_227439 | 3300042618 | Bacteria | 2142 |
| 52 | Ga0466723_343127 | 3300042618 | Bacteria | 2753 |
| 53 | Ga0466697_180988 | 3300042611 | Bacteria | 1813 |
| 54 | Ga0466705_149674 | 3300042612 | Bacteria | 73922 |
| 55 | Ga0466731_192539 | 3300042622 | Bacteria | 1638 |
| 56 | Ga0466703_130569 | 3300042636 | Bacteria | 2383 |
| 57 | Ga0466708_072517 | 3300042652 | Bacteria | 3026 |
| 58 | Ga0466727_192731 | 3300042655 | Bacteria | 2971 |
| 59 | Ga0466700_032555 | 3300042600 | Unclassified | 2204 |
| 60 | Ga0466700_126277 | 3300042600 | Unclassified | 2353 |
| 61 | Ga0466717_038525 | 3300042604 | Unclassified | 1986 |
| 62 | Ga0466717_052975 | 3300042604 | Bacteria | 3218 |
| 63 | Ga0466716_363762 | 3300042605 | Unclassified | 2648 |
| 64 | Ga0123356_10374114 | 3300010049 | Bacteria | 1555 |
| 65 | Ga0466693_256019 | 3300042592 | Bacteria | 1878 |
| 66 | Ga0466694_285032 | 3300042594 | Bacteria | 2177 |
| 67 | Ga0466699_030879 | 3300042597 | Bacteria | 1957 |
| 68 | Ga0466715_046271 | 3300042616 | Bacteria | 2060 |
| 69 | Ga0466718_019174 | 3300042617 | Bacteria | 1824 |
| 70 | Ga0466723_240639 | 3300042618 | Bacteria | 2375 |
| 71 | Ga0466723_297470 | 3300042618 | Unclassified | 2380 |
| 72 | Ga0466728_107250 | 3300042620 | Bacteria | 3158 |
| 73 | Ga0466731_291019 | 3300042622 | Bacteria | 3820 |
| 74 | Ga0466703_052185 | 3300042636 | Bacteria | 3418 |
| 75 | Ga0466700_192393 | 3300042600 | Bacteria | 2670 |
| 76 | Ga0466717_115102 | 3300042604 | Unclassified | 1538 |
| 77 | Ga0466697_054190 | 3300042611 | Unclassified | 1944 |
| 78 | Ga0123353_10333701 | 3300010167 | Bacteria | 2294 |
| 79 | Ga0415639_156688 | 3300038395 | Bacteria | 3948 |
| 80 | Ga0466711_502946 | 3300042615 | Bacteria | 2455 |
| 81 | Ga0466715_041891 | 3300042616 | Bacteria | 4117 |
| 82 | Ga0466718_073995 | 3300042617 | Unclassified | 2034 |
| 83 | Ga0466728_280473 | 3300042620 | Bacteria | 5478 |
| 84 | Ga0466716_235156 | 3300042605 | Bacteria | 1987 |
| 85 | Ga0123353_10391733 | 3300010167 | Bacteria | 2072 |
| 86 | Ga0123353_10485359 | 3300010167 | Unclassified | 1806 |
| 87 | Ga0466690_080376 | 3300042590 | Bacteria | 2168 |
| 88 | Ga0466690_391102 | 3300042590 | Bacteria | 2781 |
| 89 | Ga0466693_110322 | 3300042592 | Bacteria | 3056 |
| 90 | Ga0466693_340200 | 3300042592 | Bacteria | 3172 |
| 91 | Ga0466723_080080 | 3300042618 | Unclassified | 3008 |
| 92 | Ga0466705_021961 | 3300042612 | Bacteria | 8077 |
| 93 | Ga0466700_237127 | 3300042600 | Bacteria | 1921 |
| 94 | Ga0466716_200709 | 3300042605 | Bacteria | 2178 |
| 95 | Ga0123356_10214524 | 3300010049 | Unclassified | 1976 |
| 96 | Ga0123356_10214994 | 3300010049 | Bacteria | 1975 |
| 97 | Ga0123356_10228167 | 3300010049 | Unclassified | 1924 |
| 98 | Ga0123353_10078884 | 3300010167 | Bacteria | 5293 |
| 99 | Ga0072941_1056103 | 3300005201 | Bacteria | 8846 |
| 100 | Ga0072941_1188479 | 3300005201 | Bacteria | 2110 |
| 101 | Ga0415639_053462 | 3300038395 | Unclassified | 2196 |
| 102 | Ga0466657_028602 | 3300042582 | Bacteria | 3624 |
| 103 | Ga0466693_039697 | 3300042592 | Bacteria | 3339 |
| 104 | Ga0466693_356477 | 3300042592 | Bacteria | 1984 |
| 105 | Ga0466691_032899 | 3300042593 | Bacteria | 2209 |
| 106 | Ga0466696_479103 | 3300042596 | Bacteria | 3266 |
| 107 | Ga0466733_011784 | 3300042659 | Bacteria | 3133 |
| 108 | Ga0466705_485491 | 3300042612 | Bacteria | 1838 |
| 109 | Ga0466711_178734 | 3300042615 | Bacteria | 5084 |
| 110 | Ga0466715_315439 | 3300042616 | Bacteria | 2713 |
| 111 | Ga0466731_275374 | 3300042622 | Unclassified | 1880 |
| 112 | Ga0466731_380256 | 3300042622 | Bacteria | 1455 |
| 113 | Ga0466703_433033 | 3300042636 | Bacteria | 2215 |
| 114 | Ga0466708_287478 | 3300042652 | Bacteria | 1902 |
| 115 | Ga0466721_152729 | 3300042608 | Unclassified | 1804 |
| 116 | 2227626294 | 2225789004 | Bacteria | 2153 |
| 117 | IMNBL1DRAFT_c0026936 | 3300000062 | Bacteria | 2174 |
| 118 | JGI24702J35022_10009624 | 3300002462 | Bacteria | 5419 |
| 119 | Ga0466696_370712 | 3300042596 | Bacteria | 2315 |
| 120 | Ga0466711_002399 | 3300042615 | Bacteria | 5674 |
| 121 | Ga0466715_376582 | 3300042616 | Bacteria | 3544 |
| 122 | Ga0466726_343518 | 3300042619 | Unclassified | 1593 |
| 123 | Ga0466697_225584 | 3300042611 | Bacteria | 2243 |
| 124 | Ga0466703_364213 | 3300042636 | Bacteria | 2339 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042590 | Ga0466690_080376 | Ga0466690_080376_134_1390 | 418 |
| 2 | 3300042597 | Ga0466699_094360 | Ga0466699_094360_95_1393 | 432 |
| 3 | 3300042616 | Ga0466715_041891 | Ga0466715_041891_2563_3861 | 432 |
| 4 | 3300042616 | Ga0466715_315439 | Ga0466715_315439_1139_2437 | 432 |
| 5 | 3300042592 | Ga0466693_340200 | Ga0466693_340200_344_1669 | 441 |
| 6 | 3300042622 | Ga0466731_380256 | Ga0466731_380256_85_1410 | 441 |
| 7 | 3300042593 | Ga0466691_099858 | Ga0466691_099858_845_2206 | 453 |
| 8 | 3300042619 | Ga0466726_343518 | Ga0466726_343518_11_1384 | 457 |
| 9 | 3300042613 | Ga0466710_090096 | Ga0466710_090096_305_1684 | 459 |
| 10 | 3300010049 | Ga0123356_10374114 | Ga0123356_103741141 | 468 |
| 11 | 3300042596 | Ga0466696_370712 | Ga0466696_370712_251_1660 | 469 |
| 12 | 3300042592 | Ga0466693_356477 | Ga0466693_356477_259_1797 | 477 |
| 13 | 3300042615 | Ga0466711_216845 | Ga0466711_216845_9164_10627 | 480 |
| 14 | 3300042618 | Ga0466723_012182 | Ga0466723_012182_158_1657 | 480 |
| 15 | 3300038395 | Ga0415639_156688 | Ga0415639_156688_2218_3678 | 486 |
| 16 | 3300042593 | Ga0466691_135881 | Ga0466691_135881_266_1777 | 491 |
| 17 | 3300042592 | Ga0466693_039697 | Ga0466693_039697_288_1823 | 495 |
| 18 | 3300042643 | Ga0466704_225187 | Ga0466704_225187_1989_3479 | 496 |
| 19 | 3300010049 | Ga0123356_10014436 | Ga0123356_100144364 | 497 |
| 20 | 3300042616 | Ga0466715_283457 | Ga0466715_283457_592_2085 | 497 |
| 21 | 3300042620 | Ga0466728_399182 | Ga0466728_399182_289_1818 | 497 |
| 22 | 3300042636 | Ga0466703_052185 | Ga0466703_052185_1778_3271 | 497 |
| 23 | 3300009784 | Ga0123357_10194189 | Ga0123357_101941893 | 498 |
| 24 | 3300042610 | Ga0466698_227828 | Ga0466698_227828_250_1746 | 498 |
| 25 | 3300042612 | Ga0466705_149674 | Ga0466705_149674_53328_54824 | 498 |
| 26 | 3300005083 | Ga0068305_10083773 | Ga0068305_100837731 | 499 |
| 27 | 3300010049 | Ga0123356_10085274 | Ga0123356_100852742 | 499 |
| 28 | 3300010167 | Ga0123353_10333701 | Ga0123353_103337011 | 499 |
| 29 | 3300042598 | Ga0466701_080036 | Ga0466701_080036_284_1783 | 499 |
| 30 | 3300042582 | Ga0466657_028602 | Ga0466657_028602_1639_3177 | 500 |
| 31 | 3300042592 | Ga0466693_256019 | Ga0466693_256019_244_1782 | 500 |
| 32 | 3300042600 | Ga0466700_182489 | Ga0466700_182489_306_1844 | 500 |
| 33 | 3300042600 | Ga0466700_218468 | Ga0466700_218468_152_1690 | 500 |
| 34 | 3300042612 | Ga0466705_021961 | Ga0466705_021961_5931_7469 | 500 |
| 35 | 3300042620 | Ga0466728_107250 | Ga0466728_107250_1489_2991 | 500 |
| 36 | 3300042652 | Ga0466708_287478 | Ga0466708_287478_152_1654 | 500 |
| 37 | 3300042593 | Ga0466691_032899 | Ga0466691_032899_505_2010 | 501 |
| 38 | 3300042596 | Ga0466696_479103 | Ga0466696_479103_1183_2688 | 501 |
| 39 | 3300042604 | Ga0466717_115102 | Ga0466717_115102_15_1520 | 501 |
| 40 | 3300042608 | Ga0466721_393376 | Ga0466721_393376_365_1870 | 501 |
| 41 | 3300042611 | Ga0466697_180988 | Ga0466697_180988_179_1720 | 501 |
| 42 | 3300042617 | Ga0466718_019174 | Ga0466718_019174_236_1774 | 501 |
| 43 | 3300042618 | Ga0466723_080080 | Ga0466723_080080_141_1646 | 501 |
| 44 | 3300010049 | Ga0123356_10228167 | Ga0123356_102281671 | 502 |
| 45 | 3300042606 | Ga0466719_064099 | Ga0466719_064099_2132_3640 | 502 |
| 46 | 3300042615 | Ga0466711_178734 | Ga0466711_178734_632_2164 | 502 |
| 47 | 3300042594 | Ga0466694_285032 | Ga0466694_285032_455_1987 | 503 |
| 48 | 3300042622 | Ga0466731_192539 | Ga0466731_192539_113_1624 | 503 |
| 49 | 3300042636 | Ga0466703_433033 | Ga0466703_433033_293_1825 | 503 |
| 50 | 3300002450 | JGI24695J34938_10050882 | JGI24695J34938_100508821 | 504 |
| 51 | 3300010167 | Ga0123353_10485359 | Ga0123353_104853591 | 504 |
| 52 | 3300042605 | Ga0466716_363762 | Ga0466716_363762_494_2008 | 504 |
| 53 | 3300042612 | Ga0466705_218567 | Ga0466705_218567_1152_2666 | 504 |
| 54 | 3300042615 | Ga0466711_002399 | Ga0466711_002399_1508_3022 | 504 |
| 55 | 3300042636 | Ga0466703_364213 | Ga0466703_364213_459_1997 | 504 |
| 56 | 3300010049 | Ga0123356_10214994 | Ga0123356_102149941 | 505 |
| 57 | 3300024493 | Ga0264413_131440 | Ga0264413_1314401 | 505 |
| 58 | 3300042590 | Ga0466690_161968 | Ga0466690_161968_133_1650 | 505 |
| 59 | 3300042596 | Ga0466696_320534 | Ga0466696_320534_3305_4822 | 505 |
| 60 | 3300042607 | Ga0466720_193364 | Ga0466720_193364_35_1552 | 505 |
| 61 | 3300042612 | Ga0466705_531539 | Ga0466705_531539_530_2062 | 505 |
| 62 | 3300042618 | Ga0466723_297470 | Ga0466723_297470_340_1872 | 505 |
| 63 | 3300042655 | Ga0466727_192731 | Ga0466727_192731_888_2405 | 505 |
| 64 | 3300042655 | Ga0466727_302259 | Ga0466727_302259_81_1598 | 505 |
| 65 | 3300042659 | Ga0466733_187567 | Ga0466733_187567_240_1793 | 505 |
| 66 | 3300010167 | Ga0123353_10078884 | Ga0123353_100788842 | 506 |
| 67 | 3300038395 | Ga0415639_053462 | Ga0415639_053462_569_2089 | 506 |
| 68 | 3300042594 | Ga0466694_374017 | Ga0466694_374017_789_2309 | 506 |
| 69 | 3300042604 | Ga0466717_185389 | Ga0466717_185389_258_1778 | 506 |
| 70 | 3300042611 | Ga0466697_037267 | Ga0466697_037267_1619_3139 | 506 |
| 71 | 3300042611 | Ga0466697_225584 | Ga0466697_225584_382_1902 | 506 |
| 72 | 3300042616 | Ga0466715_046271 | Ga0466715_046271_162_1682 | 506 |
| 73 | 3300042616 | Ga0466715_376582 | Ga0466715_376582_1692_3212 | 506 |
| 74 | 3300042622 | Ga0466731_275374 | Ga0466731_275374_248_1768 | 506 |
| 75 | 3300042622 | Ga0466731_291019 | Ga0466731_291019_267_1787 | 506 |
| 76 | 3300002462 | JGI24702J35022_10077514 | JGI24702J35022_100775142 | 507 |
| 77 | 3300002504 | JGI24705J35276_12223734 | JGI24705J35276_122237343 | 507 |
| 78 | 3300010049 | Ga0123356_10214524 | Ga0123356_102145241 | 507 |
| 79 | 3300042592 | Ga0466693_110322 | Ga0466693_110322_665_2188 | 507 |
| 80 | 3300042594 | Ga0466694_279765 | Ga0466694_279765_745_2283 | 507 |
| 81 | 3300042600 | Ga0466700_032555 | Ga0466700_032555_441_1964 | 507 |
| 82 | 3300005201 | Ga0072941_1056103 | Ga0072941_10561036 | 508 |
| 83 | 3300042590 | Ga0466690_337239 | Ga0466690_337239_293_1819 | 508 |
| 84 | 3300042594 | Ga0466694_050881 | Ga0466694_050881_229_1755 | 508 |
| 85 | 3300042595 | Ga0466695_313675 | Ga0466695_313675_267_1793 | 508 |
| 86 | 3300042604 | Ga0466717_038525 | Ga0466717_038525_243_1769 | 508 |
| 87 | 3300042605 | Ga0466716_200709 | Ga0466716_200709_327_1853 | 508 |
| 88 | 3300042611 | Ga0466697_169390 | Ga0466697_169390_199_1746 | 508 |
| 89 | 3300042617 | Ga0466718_073995 | Ga0466718_073995_246_1772 | 508 |
| 90 | 3300042605 | Ga0466716_370411 | Ga0466716_370411_71_1600 | 509 |
| 91 | 3300042611 | Ga0466697_004161 | Ga0466697_004161_941_2470 | 509 |
| 92 | 3300042590 | Ga0466690_391102 | Ga0466690_391102_201_1733 | 510 |
| 93 | 3300042604 | Ga0466717_052975 | Ga0466717_052975_62_1594 | 510 |
| 94 | 3300042606 | Ga0466719_267005 | Ga0466719_267005_1063_2595 | 510 |
| 95 | 3300042618 | Ga0466723_240639 | Ga0466723_240639_624_2156 | 510 |
| 96 | 3300042618 | Ga0466723_343127 | Ga0466723_343127_554_2107 | 510 |
| 97 | 3300042620 | Ga0466728_280473 | Ga0466728_280473_512_2044 | 510 |
| 98 | 3300005201 | Ga0072941_1188479 | Ga0072941_11884792 | 511 |
| 99 | 3300010049 | Ga0123356_10144267 | Ga0123356_101442672 | 511 |
| 100 | 3300042596 | Ga0466696_330743 | Ga0466696_330743_550_2085 | 511 |
| 101 | 3300042618 | Ga0466723_227439 | Ga0466723_227439_134_1669 | 511 |
| 102 | 3300042618 | Ga0466723_259195 | Ga0466723_259195_2089_3624 | 511 |
| 103 | 2225789004 | 2227626294 | 2228207891 | 512 |
| 104 | 3300000062 | IMNBL1DRAFT_c0026936 | IMNBL1DRAFT_00269361 | 512 |
| 105 | 3300042600 | Ga0466700_237127 | Ga0466700_237127_128_1666 | 512 |
| 106 | 3300042604 | Ga0466717_038805 | Ga0466717_038805_19_1557 | 512 |
| 107 | 3300042652 | Ga0466708_072517 | Ga0466708_072517_1446_2984 | 512 |
| 108 | iso_pr_bacteria | 2820220859 | 2820223324 | 512 |
| 109 | 3300002462 | JGI24702J35022_10009624 | JGI24702J35022_100096244 | 513 |
| 110 | 3300042611 | Ga0466697_054190 | Ga0466697_054190_155_1696 | 513 |
| 111 | 3300042605 | Ga0466716_235156 | Ga0466716_235156_221_1786 | 514 |
| 112 | 3300042615 | Ga0466711_502946 | Ga0466711_502946_349_1893 | 514 |
| 113 | 3300042600 | Ga0466700_192393 | Ga0466700_192393_788_2335 | 515 |
| 114 | 3300042608 | Ga0466721_152729 | Ga0466721_152729_71_1618 | 515 |
| 115 | 3300042636 | Ga0466703_102686 | Ga0466703_102686_366_1913 | 515 |
| 116 | 3300042636 | Ga0466703_130569 | Ga0466703_130569_692_2242 | 516 |
| 117 | 3300042612 | Ga0466705_485491 | Ga0466705_485491_25_1578 | 517 |
| 118 | 3300042601 | Ga0466707_421183 | Ga0466707_421183_1739_3295 | 518 |
| 119 | 3300042606 | Ga0466719_209934 | Ga0466719_209934_305_1861 | 518 |
| 120 | 3300042597 | Ga0466699_030879 | Ga0466699_030879_249_1826 | 519 |
| 121 | 3300010167 | Ga0123353_10391733 | Ga0123353_103917332 | 520 |
| 122 | 3300042601 | Ga0466707_054930 | Ga0466707_054930_1613_3178 | 521 |
| 123 | 3300042659 | Ga0466733_011784 | Ga0466733_011784_902_2503 | 521 |
| 124 | 3300042600 | Ga0466700_126277 | Ga0466700_126277_551_2119 | 522 |
| 125 | 3300042590 | Ga0466690_213508 | Ga0466690_213508_390_2099 | 544 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01609 | DDE_Tnp_1 | Transposase DDE domain | 183 | 434 | 0.95 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m5o-assembly1.cif.gz_A | Cryo-EM structure of CasPhi-2 (Cas12j) bound to crRNA | 0.656 | 1 | 39 |
| 5m1k-assembly2.cif.gz_B | Crystal structure of the large terminase nuclease from thermophilic phage G20c with bound Magnesium | 0.58 | 216 | 300 |
| 5m1o-assembly2.cif.gz_B | Crystal structure of the large terminase nuclease from thermophilic phage G20c with bound Cobalt | 0.579 | 213 | 300 |
| 1bcm-assembly1.cif.gz_B | BACTERIOPHAGE MU TRANSPOSASE CORE DOMAIN WITH 2 MONOMERS PER ASYMMETRIC UNIT | 0.573 | 187 | 273 |
| 5m1q-assembly1.cif.gz_A | Crystal structure of the large terminase nuclease from thermophilic phage G20c with bound Zinc | 0.568 | 216 | 303 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7FF26_453_622_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.7928 | 213 | 236 | 2.60.40.150 |
| af_P0A6V8_2_105_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.77 | 184 | 265 | 3.30.420.40 |
| af_P25574_24_215_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7603 | 216 | 241 | 3.40.50.150 |
| af_Q60315_1_72_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7459 | 187 | 265 | 3.30.420.40 |
| af_M0R528_20_120_2.30.29.90 | Mainly Beta;Roll;PH-domain like; | 0.7326 | 2 | 37 | 2.30.29.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A843L0P1-F1-model_v4 | Uncharacterized/unreviewed | 0.8379 | 71 | 496 | |
| AF-A0A329MNH7-F1-model_v4 | Transposase IS4-like domain-containing protein | 0.8248 | 184 | 395 |
GO:0003677
GO:0004803 GO:0006313 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.71 | 0.75 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.