Protein Family IF04532

Metagenome Isolate
125 Members
45 Samples
124 Scaffolds
500.54 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_213508|Ga0466690_213508_390_2099
Length
544 aa
Sequence
MAYIRYVNNPSGAVYASLVDGERVGKSVKQKYLGSLGLVIDRENGIFKNYQYSIESGYSEIPSGSEHAGVGRPRKEKLILDFGDSFVLDKYLSTLPFYSAYQIVMPLHKDTLFSLLFYRILTDKKAYCYADSWWSGNYACILFPGAKLQSQRVSEFLVMLGDEEVQRKFFDEYLTTIYGKQGGTSGILIDSTGLTNMSKMSLTQLSHHNGEISMEIRLIYVIDRRNGMPIYFRYCPGNIVDVSTLCITLAELSQFNIAIDYAIVDAGYFSEGNVKELYKNNVHFVTRLAPNRTIYKQVTESELTDILSSKYAVRYGNRLVYLKKKEIDIYGYTGYAYIGVDMDSRNQQFKRTAFAAIEDKKSLEEMDERIAKLGVFILLSSDDMETSEILPLYYTRQQIEQIFDIGKNYADLLPLRVQSEDTFRGHLMLTFMATAILQMLQRDILSKRKKKDKTNPEGAFMYLRNQKCKVYGKNIIPQERVKNVNEIYKLLGIVCPTTIDSTNSPSSSRKWCGRQRKKQRRRDAVVFCGLYERQSGNYYRIHRP

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 53.5%
Kalotermitidae 30.2%
Unclassified 7.0%
Passalidae 4.7%
Termopsidae 4.7%

🌳 Taxonomy

Archaea 0
Bacteria 95
Eukaryota 0
Viruses 0
Unclassified 30

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
13 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
22 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
23 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
26 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
29 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
40 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466700_218468 3300042600 Bacteria 1895
2 Ga0466717_185389 3300042604 Bacteria 2164
3 Ga0466697_004161 3300042611 Bacteria 2593
4 Ga0466697_037267 3300042611 Unclassified 3326
5 JGI24695J34938_10050882 3300002450 Bacteria 1815
6 Ga0466690_213508 3300042590 Bacteria 2785
7 Ga0466690_337239 3300042590 Unclassified 3912
8 Ga0466705_531539 3300042612 Bacteria 2348
9 Ga0466715_283457 3300042616 Bacteria 2255
10 Ga0466728_399182 3300042620 Bacteria 2150
11 Ga0466697_169390 3300042611 Bacteria 2817
12 Ga0466703_102686 3300042636 Unclassified 1947
13 Ga0466727_302259 3300042655 Unclassified 1964
14 Ga0466700_182489 3300042600 Bacteria 2171
15 Ga0466707_421183 3300042601 Bacteria 3656
16 Ga0466717_038805 3300042604 Bacteria 1817
17 Ga0466719_064099 3300042606 Bacteria 4134
18 Ga0466720_193364 3300042607 Bacteria 2384
19 Ga0466721_393376 3300042608 Bacteria 2569
20 Ga0123356_10085274 3300010049 Bacteria 2995
21 Ga0123356_10144267 3300010049 Bacteria 2353
22 JGI24702J35022_10077514 3300002462 Unclassified 1798
23 JGI24705J35276_12223734 3300002504 Bacteria 2539
24 Ga0068305_10083773 3300005083 Unclassified 1662
25 Ga0264413_131440 3300024493 Unclassified 1944
26 Ga0466690_161968 3300042590 Unclassified 2163
27 Ga0466691_099858 3300042593 Bacteria 2243
28 Ga0466694_050881 3300042594 Bacteria 1895
29 Ga0466694_279765 3300042594 Bacteria 2795
30 Ga0466694_374017 3300042594 Bacteria 2678
31 Ga0466696_320534 3300042596 Bacteria 5197
32 Ga0466696_330743 3300042596 Bacteria 2597
33 Ga0466711_216845 3300042615 Bacteria 11004
34 Ga0466723_012182 3300042618 Bacteria 1699
35 Ga0466723_259195 3300042618 Bacteria 3762
36 Ga0466705_218567 3300042612 Bacteria 2677
37 Ga0466704_225187 3300042643 Bacteria 3917
38 Ga0466701_080036 3300042598 Unclassified 1952
39 Ga0466707_054930 3300042601 Bacteria 3295
40 Ga0466716_370411 3300042605 Unclassified 1859
41 Ga0466719_209934 3300042606 Bacteria 2202
42 Ga0466719_267005 3300042606 Bacteria 3495
43 Ga0466698_227828 3300042610 Unclassified 1810
44 Ga0123357_10194189 3300009784 Unclassified 2330
45 Ga0123356_10014436 3300010049 Bacteria 7595
46 Ga0466691_135881 3300042593 Bacteria 2662
47 Ga0466695_313675 3300042595 Bacteria 1872
48 Ga0466699_094360 3300042597 Unclassified 1854
49 Ga0466733_187567 3300042659 Unclassified 1881
50 Ga0466710_090096 3300042613 Bacteria 1741
51 Ga0466723_227439 3300042618 Bacteria 2142
52 Ga0466723_343127 3300042618 Bacteria 2753
53 Ga0466697_180988 3300042611 Bacteria 1813
54 Ga0466705_149674 3300042612 Bacteria 73922
55 Ga0466731_192539 3300042622 Bacteria 1638
56 Ga0466703_130569 3300042636 Bacteria 2383
57 Ga0466708_072517 3300042652 Bacteria 3026
58 Ga0466727_192731 3300042655 Bacteria 2971
59 Ga0466700_032555 3300042600 Unclassified 2204
60 Ga0466700_126277 3300042600 Unclassified 2353
61 Ga0466717_038525 3300042604 Unclassified 1986
62 Ga0466717_052975 3300042604 Bacteria 3218
63 Ga0466716_363762 3300042605 Unclassified 2648
64 Ga0123356_10374114 3300010049 Bacteria 1555
65 Ga0466693_256019 3300042592 Bacteria 1878
66 Ga0466694_285032 3300042594 Bacteria 2177
67 Ga0466699_030879 3300042597 Bacteria 1957
68 Ga0466715_046271 3300042616 Bacteria 2060
69 Ga0466718_019174 3300042617 Bacteria 1824
70 Ga0466723_240639 3300042618 Bacteria 2375
71 Ga0466723_297470 3300042618 Unclassified 2380
72 Ga0466728_107250 3300042620 Bacteria 3158
73 Ga0466731_291019 3300042622 Bacteria 3820
74 Ga0466703_052185 3300042636 Bacteria 3418
75 Ga0466700_192393 3300042600 Bacteria 2670
76 Ga0466717_115102 3300042604 Unclassified 1538
77 Ga0466697_054190 3300042611 Unclassified 1944
78 Ga0123353_10333701 3300010167 Bacteria 2294
79 Ga0415639_156688 3300038395 Bacteria 3948
80 Ga0466711_502946 3300042615 Bacteria 2455
81 Ga0466715_041891 3300042616 Bacteria 4117
82 Ga0466718_073995 3300042617 Unclassified 2034
83 Ga0466728_280473 3300042620 Bacteria 5478
84 Ga0466716_235156 3300042605 Bacteria 1987
85 Ga0123353_10391733 3300010167 Bacteria 2072
86 Ga0123353_10485359 3300010167 Unclassified 1806
87 Ga0466690_080376 3300042590 Bacteria 2168
88 Ga0466690_391102 3300042590 Bacteria 2781
89 Ga0466693_110322 3300042592 Bacteria 3056
90 Ga0466693_340200 3300042592 Bacteria 3172
91 Ga0466723_080080 3300042618 Unclassified 3008
92 Ga0466705_021961 3300042612 Bacteria 8077
93 Ga0466700_237127 3300042600 Bacteria 1921
94 Ga0466716_200709 3300042605 Bacteria 2178
95 Ga0123356_10214524 3300010049 Unclassified 1976
96 Ga0123356_10214994 3300010049 Bacteria 1975
97 Ga0123356_10228167 3300010049 Unclassified 1924
98 Ga0123353_10078884 3300010167 Bacteria 5293
99 Ga0072941_1056103 3300005201 Bacteria 8846
100 Ga0072941_1188479 3300005201 Bacteria 2110
101 Ga0415639_053462 3300038395 Unclassified 2196
102 Ga0466657_028602 3300042582 Bacteria 3624
103 Ga0466693_039697 3300042592 Bacteria 3339
104 Ga0466693_356477 3300042592 Bacteria 1984
105 Ga0466691_032899 3300042593 Bacteria 2209
106 Ga0466696_479103 3300042596 Bacteria 3266
107 Ga0466733_011784 3300042659 Bacteria 3133
108 Ga0466705_485491 3300042612 Bacteria 1838
109 Ga0466711_178734 3300042615 Bacteria 5084
110 Ga0466715_315439 3300042616 Bacteria 2713
111 Ga0466731_275374 3300042622 Unclassified 1880
112 Ga0466731_380256 3300042622 Bacteria 1455
113 Ga0466703_433033 3300042636 Bacteria 2215
114 Ga0466708_287478 3300042652 Bacteria 1902
115 Ga0466721_152729 3300042608 Unclassified 1804
116 2227626294 2225789004 Bacteria 2153
117 IMNBL1DRAFT_c0026936 3300000062 Bacteria 2174
118 JGI24702J35022_10009624 3300002462 Bacteria 5419
119 Ga0466696_370712 3300042596 Bacteria 2315
120 Ga0466711_002399 3300042615 Bacteria 5674
121 Ga0466715_376582 3300042616 Bacteria 3544
122 Ga0466726_343518 3300042619 Unclassified 1593
123 Ga0466697_225584 3300042611 Bacteria 2243
124 Ga0466703_364213 3300042636 Bacteria 2339

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_080376 Ga0466690_080376_134_1390 418
2 3300042597 Ga0466699_094360 Ga0466699_094360_95_1393 432
3 3300042616 Ga0466715_041891 Ga0466715_041891_2563_3861 432
4 3300042616 Ga0466715_315439 Ga0466715_315439_1139_2437 432
5 3300042592 Ga0466693_340200 Ga0466693_340200_344_1669 441
6 3300042622 Ga0466731_380256 Ga0466731_380256_85_1410 441
7 3300042593 Ga0466691_099858 Ga0466691_099858_845_2206 453
8 3300042619 Ga0466726_343518 Ga0466726_343518_11_1384 457
9 3300042613 Ga0466710_090096 Ga0466710_090096_305_1684 459
10 3300010049 Ga0123356_10374114 Ga0123356_103741141 468
11 3300042596 Ga0466696_370712 Ga0466696_370712_251_1660 469
12 3300042592 Ga0466693_356477 Ga0466693_356477_259_1797 477
13 3300042615 Ga0466711_216845 Ga0466711_216845_9164_10627 480
14 3300042618 Ga0466723_012182 Ga0466723_012182_158_1657 480
15 3300038395 Ga0415639_156688 Ga0415639_156688_2218_3678 486
16 3300042593 Ga0466691_135881 Ga0466691_135881_266_1777 491
17 3300042592 Ga0466693_039697 Ga0466693_039697_288_1823 495
18 3300042643 Ga0466704_225187 Ga0466704_225187_1989_3479 496
19 3300010049 Ga0123356_10014436 Ga0123356_100144364 497
20 3300042616 Ga0466715_283457 Ga0466715_283457_592_2085 497
21 3300042620 Ga0466728_399182 Ga0466728_399182_289_1818 497
22 3300042636 Ga0466703_052185 Ga0466703_052185_1778_3271 497
23 3300009784 Ga0123357_10194189 Ga0123357_101941893 498
24 3300042610 Ga0466698_227828 Ga0466698_227828_250_1746 498
25 3300042612 Ga0466705_149674 Ga0466705_149674_53328_54824 498
26 3300005083 Ga0068305_10083773 Ga0068305_100837731 499
27 3300010049 Ga0123356_10085274 Ga0123356_100852742 499
28 3300010167 Ga0123353_10333701 Ga0123353_103337011 499
29 3300042598 Ga0466701_080036 Ga0466701_080036_284_1783 499
30 3300042582 Ga0466657_028602 Ga0466657_028602_1639_3177 500
31 3300042592 Ga0466693_256019 Ga0466693_256019_244_1782 500
32 3300042600 Ga0466700_182489 Ga0466700_182489_306_1844 500
33 3300042600 Ga0466700_218468 Ga0466700_218468_152_1690 500
34 3300042612 Ga0466705_021961 Ga0466705_021961_5931_7469 500
35 3300042620 Ga0466728_107250 Ga0466728_107250_1489_2991 500
36 3300042652 Ga0466708_287478 Ga0466708_287478_152_1654 500
37 3300042593 Ga0466691_032899 Ga0466691_032899_505_2010 501
38 3300042596 Ga0466696_479103 Ga0466696_479103_1183_2688 501
39 3300042604 Ga0466717_115102 Ga0466717_115102_15_1520 501
40 3300042608 Ga0466721_393376 Ga0466721_393376_365_1870 501
41 3300042611 Ga0466697_180988 Ga0466697_180988_179_1720 501
42 3300042617 Ga0466718_019174 Ga0466718_019174_236_1774 501
43 3300042618 Ga0466723_080080 Ga0466723_080080_141_1646 501
44 3300010049 Ga0123356_10228167 Ga0123356_102281671 502
45 3300042606 Ga0466719_064099 Ga0466719_064099_2132_3640 502
46 3300042615 Ga0466711_178734 Ga0466711_178734_632_2164 502
47 3300042594 Ga0466694_285032 Ga0466694_285032_455_1987 503
48 3300042622 Ga0466731_192539 Ga0466731_192539_113_1624 503
49 3300042636 Ga0466703_433033 Ga0466703_433033_293_1825 503
50 3300002450 JGI24695J34938_10050882 JGI24695J34938_100508821 504
51 3300010167 Ga0123353_10485359 Ga0123353_104853591 504
52 3300042605 Ga0466716_363762 Ga0466716_363762_494_2008 504
53 3300042612 Ga0466705_218567 Ga0466705_218567_1152_2666 504
54 3300042615 Ga0466711_002399 Ga0466711_002399_1508_3022 504
55 3300042636 Ga0466703_364213 Ga0466703_364213_459_1997 504
56 3300010049 Ga0123356_10214994 Ga0123356_102149941 505
57 3300024493 Ga0264413_131440 Ga0264413_1314401 505
58 3300042590 Ga0466690_161968 Ga0466690_161968_133_1650 505
59 3300042596 Ga0466696_320534 Ga0466696_320534_3305_4822 505
60 3300042607 Ga0466720_193364 Ga0466720_193364_35_1552 505
61 3300042612 Ga0466705_531539 Ga0466705_531539_530_2062 505
62 3300042618 Ga0466723_297470 Ga0466723_297470_340_1872 505
63 3300042655 Ga0466727_192731 Ga0466727_192731_888_2405 505
64 3300042655 Ga0466727_302259 Ga0466727_302259_81_1598 505
65 3300042659 Ga0466733_187567 Ga0466733_187567_240_1793 505
66 3300010167 Ga0123353_10078884 Ga0123353_100788842 506
67 3300038395 Ga0415639_053462 Ga0415639_053462_569_2089 506
68 3300042594 Ga0466694_374017 Ga0466694_374017_789_2309 506
69 3300042604 Ga0466717_185389 Ga0466717_185389_258_1778 506
70 3300042611 Ga0466697_037267 Ga0466697_037267_1619_3139 506
71 3300042611 Ga0466697_225584 Ga0466697_225584_382_1902 506
72 3300042616 Ga0466715_046271 Ga0466715_046271_162_1682 506
73 3300042616 Ga0466715_376582 Ga0466715_376582_1692_3212 506
74 3300042622 Ga0466731_275374 Ga0466731_275374_248_1768 506
75 3300042622 Ga0466731_291019 Ga0466731_291019_267_1787 506
76 3300002462 JGI24702J35022_10077514 JGI24702J35022_100775142 507
77 3300002504 JGI24705J35276_12223734 JGI24705J35276_122237343 507
78 3300010049 Ga0123356_10214524 Ga0123356_102145241 507
79 3300042592 Ga0466693_110322 Ga0466693_110322_665_2188 507
80 3300042594 Ga0466694_279765 Ga0466694_279765_745_2283 507
81 3300042600 Ga0466700_032555 Ga0466700_032555_441_1964 507
82 3300005201 Ga0072941_1056103 Ga0072941_10561036 508
83 3300042590 Ga0466690_337239 Ga0466690_337239_293_1819 508
84 3300042594 Ga0466694_050881 Ga0466694_050881_229_1755 508
85 3300042595 Ga0466695_313675 Ga0466695_313675_267_1793 508
86 3300042604 Ga0466717_038525 Ga0466717_038525_243_1769 508
87 3300042605 Ga0466716_200709 Ga0466716_200709_327_1853 508
88 3300042611 Ga0466697_169390 Ga0466697_169390_199_1746 508
89 3300042617 Ga0466718_073995 Ga0466718_073995_246_1772 508
90 3300042605 Ga0466716_370411 Ga0466716_370411_71_1600 509
91 3300042611 Ga0466697_004161 Ga0466697_004161_941_2470 509
92 3300042590 Ga0466690_391102 Ga0466690_391102_201_1733 510
93 3300042604 Ga0466717_052975 Ga0466717_052975_62_1594 510
94 3300042606 Ga0466719_267005 Ga0466719_267005_1063_2595 510
95 3300042618 Ga0466723_240639 Ga0466723_240639_624_2156 510
96 3300042618 Ga0466723_343127 Ga0466723_343127_554_2107 510
97 3300042620 Ga0466728_280473 Ga0466728_280473_512_2044 510
98 3300005201 Ga0072941_1188479 Ga0072941_11884792 511
99 3300010049 Ga0123356_10144267 Ga0123356_101442672 511
100 3300042596 Ga0466696_330743 Ga0466696_330743_550_2085 511
101 3300042618 Ga0466723_227439 Ga0466723_227439_134_1669 511
102 3300042618 Ga0466723_259195 Ga0466723_259195_2089_3624 511
103 2225789004 2227626294 2228207891 512
104 3300000062 IMNBL1DRAFT_c0026936 IMNBL1DRAFT_00269361 512
105 3300042600 Ga0466700_237127 Ga0466700_237127_128_1666 512
106 3300042604 Ga0466717_038805 Ga0466717_038805_19_1557 512
107 3300042652 Ga0466708_072517 Ga0466708_072517_1446_2984 512
108 iso_pr_bacteria 2820220859 2820223324 512
109 3300002462 JGI24702J35022_10009624 JGI24702J35022_100096244 513
110 3300042611 Ga0466697_054190 Ga0466697_054190_155_1696 513
111 3300042605 Ga0466716_235156 Ga0466716_235156_221_1786 514
112 3300042615 Ga0466711_502946 Ga0466711_502946_349_1893 514
113 3300042600 Ga0466700_192393 Ga0466700_192393_788_2335 515
114 3300042608 Ga0466721_152729 Ga0466721_152729_71_1618 515
115 3300042636 Ga0466703_102686 Ga0466703_102686_366_1913 515
116 3300042636 Ga0466703_130569 Ga0466703_130569_692_2242 516
117 3300042612 Ga0466705_485491 Ga0466705_485491_25_1578 517
118 3300042601 Ga0466707_421183 Ga0466707_421183_1739_3295 518
119 3300042606 Ga0466719_209934 Ga0466719_209934_305_1861 518
120 3300042597 Ga0466699_030879 Ga0466699_030879_249_1826 519
121 3300010167 Ga0123353_10391733 Ga0123353_103917332 520
122 3300042601 Ga0466707_054930 Ga0466707_054930_1613_3178 521
123 3300042659 Ga0466733_011784 Ga0466733_011784_902_2503 521
124 3300042600 Ga0466700_126277 Ga0466700_126277_551_2119 522
125 3300042590 Ga0466690_213508 Ga0466690_213508_390_2099 544

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01609 DDE_Tnp_1 Transposase DDE domain 183 434 0.95

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
7m5o-assembly1.cif.gz_A Cryo-EM structure of CasPhi-2 (Cas12j) bound to crRNA 0.656 1 39
5m1k-assembly2.cif.gz_B Crystal structure of the large terminase nuclease from thermophilic phage G20c with bound Magnesium 0.58 216 300
5m1o-assembly2.cif.gz_B Crystal structure of the large terminase nuclease from thermophilic phage G20c with bound Cobalt 0.579 213 300
1bcm-assembly1.cif.gz_B BACTERIOPHAGE MU TRANSPOSASE CORE DOMAIN WITH 2 MONOMERS PER ASYMMETRIC UNIT 0.573 187 273
5m1q-assembly1.cif.gz_A Crystal structure of the large terminase nuclease from thermophilic phage G20c with bound Zinc 0.568 216 303
IDDescriptionScoreStartEndSuperfamily
af_E7FF26_453_622_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.7928 213 236 2.60.40.150
af_P0A6V8_2_105_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.77 184 265 3.30.420.40
af_P25574_24_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7603 216 241 3.40.50.150
af_Q60315_1_72_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7459 187 265 3.30.420.40
af_M0R528_20_120_2.30.29.90 Mainly Beta;Roll;PH-domain like; 0.7326 2 37 2.30.29.90
IDDescriptionScoreStartEndGO Terms
AF-A0A843L0P1-F1-model_v4 Uncharacterized/unreviewed 0.8379 71 496
AF-A0A329MNH7-F1-model_v4 Transposase IS4-like domain-containing protein 0.8248 184 395 GO:0003677
GO:0004803
GO:0006313

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.